PLIN5 (perilipin 5)

Gene

• Entrez ID: 440503
• Gene name: Perilipin 5
• Gene symbol: PLIN5
• Synonyms (NCBI Gene): LSDA5, LSDP5, MLDP, OXPAT
• Chromosome: 19
• Chromosome location: 19p13.3
• Summary: Members of the perilipin family, such as PLIN5, coat intracellular lipid storage droplets and protect them from lipolytic degradation (Dalen et al., 2007 [PubMed 17234449]).[supplied by OMIM, Feb 2010]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT541859	hsa-miR-4418	PAR-CLIP	21572407
MIRT541857	hsa-miR-509-3-5p	PAR-CLIP	21572407
MIRT541858	hsa-miR-509-5p	PAR-CLIP	21572407
MIRT541856	hsa-miR-6890-3p	PAR-CLIP	21572407
MIRT541855	hsa-miR-939-3p	PAR-CLIP	21572407
MIRT541854	hsa-miR-6852-5p	PAR-CLIP	21572407
MIRT541852	hsa-miR-6742-3p	PAR-CLIP	21572407
MIRT541853	hsa-miR-1304-3p	PAR-CLIP	21572407
MIRT541851	hsa-miR-1184	PAR-CLIP	21572407
MIRT541850	hsa-miR-378g	PAR-CLIP	21572407
MIRT541849	hsa-miR-4284	PAR-CLIP	21572407
MIRT541847	hsa-miR-24-3p	PAR-CLIP	21572407
MIRT541848	hsa-miR-4437	PAR-CLIP	21572407
MIRT541846	hsa-miR-1343-3p	PAR-CLIP	21572407
MIRT541845	hsa-miR-6783-3p	PAR-CLIP	21572407
MIRT541844	hsa-miR-7156-3p	PAR-CLIP	21572407
MIRT541843	hsa-miR-4674	PAR-CLIP	21572407
MIRT541859	hsa-miR-4418	PAR-CLIP	21572407
MIRT541857	hsa-miR-509-3-5p	PAR-CLIP	21572407
MIRT541858	hsa-miR-509-5p	PAR-CLIP	21572407
MIRT541856	hsa-miR-6890-3p	PAR-CLIP	21572407
MIRT541855	hsa-miR-939-3p	PAR-CLIP	21572407
MIRT541854	hsa-miR-6852-5p	PAR-CLIP	21572407
MIRT541852	hsa-miR-6742-3p	PAR-CLIP	21572407
MIRT541853	hsa-miR-1304-3p	PAR-CLIP	21572407
MIRT541851	hsa-miR-1184	PAR-CLIP	21572407
MIRT541850	hsa-miR-378g	PAR-CLIP	21572407
MIRT541849	hsa-miR-4284	PAR-CLIP	21572407
MIRT541847	hsa-miR-24-3p	PAR-CLIP	21572407
MIRT541848	hsa-miR-4437	PAR-CLIP	21572407
MIRT541846	hsa-miR-1343-3p	PAR-CLIP	21572407
MIRT541845	hsa-miR-6783-3p	PAR-CLIP	21572407
MIRT541844	hsa-miR-7156-3p	PAR-CLIP	21572407
MIRT541843	hsa-miR-4674	PAR-CLIP	21572407
MIRT1242874	hsa-miR-1343	CLIP-seq
MIRT1242875	hsa-miR-138	CLIP-seq
MIRT1242876	hsa-miR-1910	CLIP-seq
MIRT1242877	hsa-miR-24	CLIP-seq
MIRT1242878	hsa-miR-2681	CLIP-seq
MIRT1242879	hsa-miR-3650	CLIP-seq
MIRT1242880	hsa-miR-3944-5p	CLIP-seq
MIRT1242881	hsa-miR-4252	CLIP-seq
MIRT1242882	hsa-miR-4274	CLIP-seq
MIRT1242883	hsa-miR-4438	CLIP-seq
MIRT1242884	hsa-miR-4634	CLIP-seq
MIRT1242885	hsa-miR-5095	CLIP-seq
MIRT2071772	hsa-miR-1228	CLIP-seq
MIRT2071773	hsa-miR-1286	CLIP-seq
MIRT1242874	hsa-miR-1343	CLIP-seq
MIRT1242875	hsa-miR-138	CLIP-seq
MIRT1242877	hsa-miR-24	CLIP-seq
MIRT1242878	hsa-miR-2681	CLIP-seq
MIRT2071774	hsa-miR-31	CLIP-seq
MIRT2071775	hsa-miR-3119	CLIP-seq
MIRT2071776	hsa-miR-3185	CLIP-seq
MIRT1242879	hsa-miR-3650	CLIP-seq
MIRT1242880	hsa-miR-3944-5p	CLIP-seq
MIRT2071777	hsa-miR-4270	CLIP-seq
MIRT2071778	hsa-miR-4436a	CLIP-seq
MIRT2071779	hsa-miR-4441	CLIP-seq
MIRT1242884	hsa-miR-4634	CLIP-seq
MIRT2071780	hsa-miR-548b-3p	CLIP-seq
MIRT2298927	hsa-miR-1245b-3p	CLIP-seq
MIRT2071773	hsa-miR-1286	CLIP-seq
MIRT1242874	hsa-miR-1343	CLIP-seq
MIRT1242875	hsa-miR-138	CLIP-seq
MIRT1242877	hsa-miR-24	CLIP-seq
MIRT2071776	hsa-miR-3185	CLIP-seq
MIRT1242879	hsa-miR-3650	CLIP-seq
MIRT2298928	hsa-miR-3942-3p	CLIP-seq
MIRT1242880	hsa-miR-3944-5p	CLIP-seq
MIRT2071777	hsa-miR-4270	CLIP-seq
MIRT2071778	hsa-miR-4436a	CLIP-seq
MIRT2071779	hsa-miR-4441	CLIP-seq
MIRT1242884	hsa-miR-4634	CLIP-seq
MIRT2071780	hsa-miR-548b-3p	CLIP-seq
MIRT2298929	hsa-miR-552	CLIP-seq
MIRT2298930	hsa-miR-617	CLIP-seq
MIRT2298931	hsa-miR-640	CLIP-seq
MIRT1242874	hsa-miR-1343	CLIP-seq
MIRT2456700	hsa-miR-1224-3p	CLIP-seq
MIRT2071772	hsa-miR-1228	CLIP-seq
MIRT2456701	hsa-miR-1260	CLIP-seq
MIRT2456702	hsa-miR-1260b	CLIP-seq
MIRT2456703	hsa-miR-1280	CLIP-seq
MIRT1242876	hsa-miR-1910	CLIP-seq
MIRT1242877	hsa-miR-24	CLIP-seq
MIRT2071775	hsa-miR-3119	CLIP-seq
MIRT2456704	hsa-miR-3199	CLIP-seq
MIRT1242882	hsa-miR-4274	CLIP-seq
MIRT2456705	hsa-miR-532-3p	CLIP-seq
MIRT2298929	hsa-miR-552	CLIP-seq
MIRT2456706	hsa-miR-764	CLIP-seq
MIRT1242877	hsa-miR-24	CLIP-seq
MIRT2071772	hsa-miR-1228	CLIP-seq
MIRT2071775	hsa-miR-3119	CLIP-seq
MIRT2071772	hsa-miR-1228	CLIP-seq
MIRT2071775	hsa-miR-3119	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	ISS
GO:0005811	Component	Lipid droplet	IBA
GO:0005811	Component	Lipid droplet	IDA
GO:0005811	Component	Lipid droplet	IEA
GO:0005811	Component	Lipid droplet	ISS
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IEA
GO:0010867	Process	Positive regulation of triglyceride biosynthetic process	IEA
GO:0010867	Process	Positive regulation of triglyceride biosynthetic process	ISS
GO:0010884	Process	Positive regulation of lipid storage	IEA
GO:0010884	Process	Positive regulation of lipid storage	ISS
GO:0010890	Process	Positive regulation of triglyceride storage	IBA
GO:0010890	Process	Positive regulation of triglyceride storage	IEA
GO:0010890	Process	Positive regulation of triglyceride storage	ISS
GO:0010897	Process	Negative regulation of triglyceride catabolic process	IEA
GO:0010897	Process	Negative regulation of triglyceride catabolic process	ISS
GO:0019915	Process	Lipid storage	IBA
GO:0019915	Process	Lipid storage	IEA
GO:0031999	Process	Negative regulation of fatty acid beta-oxidation	IEA
GO:0031999	Process	Negative regulation of fatty acid beta-oxidation	ISS
GO:0032000	Process	Positive regulation of fatty acid beta-oxidation	IEA
GO:0032000	Process	Positive regulation of fatty acid beta-oxidation	ISS
GO:0034389	Process	Lipid droplet organization	IEA
GO:0034389	Process	Lipid droplet organization	ISS
GO:0035359	Process	Negative regulation of peroxisome proliferator activated receptor signaling pathway	IEA
GO:0035359	Process	Negative regulation of peroxisome proliferator activated receptor signaling pathway	ISS
GO:0035473	Function	Lipase binding	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0050995	Process	Negative regulation of lipid catabolic process	IEA
GO:0051646	Process	Mitochondrion localization	IEA
GO:0060192	Process	Negative regulation of lipase activity	ISS
GO:0060193	Process	Positive regulation of lipase activity	ISS
GO:2000378	Process	Negative regulation of reactive oxygen species metabolic process	IEA
GO:2000378	Process	Negative regulation of reactive oxygen species metabolic process	ISS

Other IDs

• MIM: 613248
• HGNC: 33196
• e!Ensembl: ENSG00000214456

Protein

• UniProt ID: Q00G26
• Protein name: Perilipin-5 (Lipid storage droplet protein 5)
• Protein function: Lipid droplet-associated protein that maintains the balance between lipogenesis and lipolysis and also regulates fatty acid oxidation in oxidative tissues. Recruits mitochondria to the surface of lipid droplets and is involved in lipid droplet h
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03036	Perilipin	15 → 382	Perilipin family	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in skeletal muscle, liver, heart and kidney. {ECO:0000269|PubMed:17234449}.
• Sequence:

  MSEEEAAQIPRSSVWEQDQQNVVQRVVALPLVRATCTAVCDVYSAAKDRHPLLGSACRLA
  ENCVCGLTTRALDHAQPLLEHLQPQLATMNSLACRGLDKLEEKLPFLQQPSETVVTSAKD
  VVASSVTGVVDLARRGRRWSVELKRSVSHAVDVVLEKSEELVDHFLPMTEEELAALAAEA
  EGPEVGSVEDQRRQQGYFVRLGSLSARIRHLAYEHSVGKLRQSKHRAQDTLAQLQETLEL
  IDHMQCGVTPTAPACPGKVHELWGEWGQRPPESRRRSQAELETLVLSRSLTQELQGTVEA
  LESSVRGLPAGAQEKVAEVRRSVDALQTAFADARCFRDVPAAALAEGRGRVAHAHACVDE
  LLELVVQAVPLPWLVGPFAPILVERPEPLPDLADLVDEVIGGPDPRWAHLDWPAQQRAWE
  AEHRDGSGNGDGDRMGVAGDICEQEPETPSCPVKHTLMPELDF

• Sequence length: 463

Pathways

KEGG:

PPAR signaling pathway

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Arteriosclerosis	Arteriosclerosis	BEFREE	29215758, 31297870		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	29215758, 31297870		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	31173228		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	37108378	Stimulate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	31291602		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	27376234		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	33482299	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	29110300		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	29317465		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	36611868	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	27428080		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	27075244	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	31291602		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	26864436	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Calculi	Kidney stone	BEFREE	31042422		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	30893876		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	30552616		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	31711773		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	27376234		★☆☆☆☆ Found in Text Mining only
Nephrolithiasis	Nephrolithiasis	BEFREE	31042422		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	27428080, 31274012		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	18812483	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	19385027		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	25342854	Inhibit	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	30552616		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	29752569		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	36478991	Associate	★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	27428080, 30954078		★☆☆☆☆ Found in Text Mining only