IFIT1B (interferon induced protein with tetratricopeptide repeats 1B)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 439996
Gene name Interferon induced protein with tetratricopeptide repeats 1B
Gene symbol IFIT1B
Synonyms (NCBI Gene)
IFIT1LbA149I23.6
Chromosome 10
Chromosome location 10q23.31
miRNA miRNA information provided by mirtarbase database.
10
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (10)
miRTarBase ID miRNA Experiments Reference
MIRT1060313 hsa-miR-1179 CLIP-seq
MIRT1060314 hsa-miR-1289 CLIP-seq
MIRT1060315 hsa-miR-2110 CLIP-seq
MIRT1060316 hsa-miR-3198 CLIP-seq
MIRT1060317 hsa-miR-4271 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
7
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (7)
GO ID Ontology Definition Evidence Reference
GO:0003723 Function RNA binding IBA
GO:0005515 Function Protein binding IPI 21642987, 32296183
GO:0005829 Component Cytosol IBA
GO:0051607 Process Defense response to virus IBA
GO:0051707 Process Response to other organism IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q5T764
Protein name Protein IFIT1 homolog B (Interferon-induced protein with tetratricopeptide repeats 1-like protein) (Interferon-induced protein with tetratricopeptide repeats 1B)
Protein function IFIT1B is likely non-functional, lacking the critical antiviral role of IFIT1. Unlike IFIT1, which is essential in the innate immune response as part of an interferon-dependent multiprotein complex, IFIT1B does not prevent the translation of vir
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13424 TPR_12 51 → 127 Repeat
PF13181 TPR_8 154 → 174 Tetratricopeptide repeat Repeat
PF13176 TPR_7 342 → 379 Tetratricopeptide repeat Repeat
Sequence 
MSEESDGKLIEDSLIQLRCHFTWKLLIEAPEIPDLENRIWEEIQFLDTKYNVGIHNLLAY
VKHLKGQNEEALVSLKKAEDLIQKEHANQADIRSLVTWGNFAWVYYHMGRLAEAQTYLDK
VENTCKKFANPSRYRMECPEVDCEEGWALAKCGGKNYERAKTCFEKALEGNPENPEFNTG
YAITVYRLDKFNTASGRNKAFSLHVLKRAVRLNPDDVYIRVLLALKLQDEGQEAEGEKYI
EEALTSISSQAYVFQYAAKFYRRKGSVDKALELLKMALETTPTSAFLHHQMGLCYRAQMI
QIKEATNWQPRGQDRETVDRLVQLAICKFEKTIMLKRTFEMAYVDLAETYAEIGHHRKAE
EHFQKGLRMKIFEDQLKQEIHYHYGRFQEHHGKSQDKAITHYLKGLKIEKMSHSREKLLN
ALEKLAKRCIHQNVRVVESVSLLGLIHKLKGEVSDALLCYERALRLAADLNPIF
Sequence length 474
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG 
  Hepatitis C  
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Show/Hide Unknown Diseases (2)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
High myopia Uncertain significance ClinVar
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
SEVERE MYOPIA — Disgenet
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations