MPST (mercaptopyruvate sulfurtransferase)

Gene

• Entrez ID: 4357
• Gene name: Mercaptopyruvate sulfurtransferase
• Gene symbol: MPST
• Synonyms (NCBI Gene): MST, TST2, TUM1
• Chromosome: 22
• Chromosome location: 22q12.3
• Summary: This protein encoded by this gene catalyzes the transfer of a sulfur ion from 3-mercaptopyruvate to cyanide or other thiol compounds. It may be involved in cysteine degradation and cyanide detoxification. There is confusion in literature between this prot

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT016463	hsa-miR-193b-3p	Microarray	20304954
MIRT021491	hsa-miR-191-5p	Sequencing	20371350
MIRT1156968	hsa-miR-298	CLIP-seq
MIRT1156969	hsa-miR-4633-3p	CLIP-seq
MIRT2274152	hsa-miR-105	CLIP-seq
MIRT2274153	hsa-miR-1273f	CLIP-seq
MIRT2274154	hsa-miR-1343	CLIP-seq
MIRT2274155	hsa-miR-143	CLIP-seq
MIRT2274156	hsa-miR-191	CLIP-seq
MIRT2274157	hsa-miR-219-1-3p	CLIP-seq
MIRT2274158	hsa-miR-3176	CLIP-seq
MIRT2274159	hsa-miR-3622a-3p	CLIP-seq
MIRT2274160	hsa-miR-3622b-3p	CLIP-seq
MIRT2274161	hsa-miR-3922-3p	CLIP-seq
MIRT2274162	hsa-miR-4682	CLIP-seq
MIRT2274163	hsa-miR-4708-5p	CLIP-seq
MIRT2274164	hsa-miR-4715-3p	CLIP-seq
MIRT2274165	hsa-miR-4770	CLIP-seq
MIRT2274166	hsa-miR-571	CLIP-seq
MIRT2274167	hsa-miR-95	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000098	Process	Sulfur amino acid catabolic process	IEA
GO:0000098	Process	Sulfur amino acid catabolic process	TAS
GO:0001822	Process	Kidney development	IEA
GO:0001889	Process	Liver development	IEA
GO:0004792	Function	Thiosulfate-cyanide sulfurtransferase activity	IBA
GO:0004792	Function	Thiosulfate-cyanide sulfurtransferase activity	IEA
GO:0004792	Function	Thiosulfate-cyanide sulfurtransferase activity	TAS
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IEA
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0009440	Process	Cyanate catabolic process	IEA
GO:0009440	Process	Cyanate catabolic process	TAS
GO:0009636	Process	Response to toxic substance	TAS
GO:0016740	Function	Transferase activity	IEA
GO:0016783	Function	Sulfurtransferase activity	IEA
GO:0016784	Function	3-mercaptopyruvate sulfurtransferase activity	IBA
GO:0016784	Function	3-mercaptopyruvate sulfurtransferase activity	IEA
GO:0016784	Function	3-mercaptopyruvate sulfurtransferase activity	ISS
GO:0016784	Function	3-mercaptopyruvate sulfurtransferase activity	TAS
GO:0019346	Process	Transsulfuration	IEA
GO:0021510	Process	Spinal cord development	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0043005	Component	Neuron projection	IEA
GO:0043005	Component	Neuron projection	ISS
GO:0045202	Component	Synapse	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0070814	Process	Hydrogen sulfide biosynthetic process	IEA
GO:0070814	Process	Hydrogen sulfide biosynthetic process	ISS

Other IDs

• MIM: 602496
• HGNC: 7223
• e!Ensembl: ENSG00000128309

Protein

• UniProt ID: P25325
• Protein name: 3-mercaptopyruvate sulfurtransferase (MST) (EC 2.8.1.2)
• Protein function: Transfer of a sulfur ion to cyanide or to other thiol compounds. Also has weak rhodanese activity. Detoxifies cyanide and is required for thiosulfate biosynthesis. Acts as an antioxidant. In combination with cysteine aminotransferase (CAT), cont
• PDB: 3OLH, 4JGT
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00581	Rhodanese	12 → 138	Rhodanese-like domain	Domain
  PF00581	Rhodanese	165 → 282	Rhodanese-like domain	Domain

• Sequence:

  MASPQLCRALVSAQWVAEALRAPRAGQPLQLLDASWYLPKLGRDARREFEERHIPGAAFF
  DIDQCSDRTSPYDHMLPGAEHFAEYAGRLGVGAATHVVIYDASDQGLYSAPRVWWMFRAF
  GHHAVSLLDGGLRHWLRQNLPLSSGKSQPAPAEFRAQLDPAFIKTYEDIKENLESRRFQV
  VDSRATGRFRGTEPEPRDGIEPGHIPGTVNIPFTDFLSQEGLEKSPEEIRHLFQEKKVDL
  SKPLVATCGSGVTACHVALGAYLCGKPDVPIYDGSWVEWYMRARPEDVISEGRGKTH

• Sequence length: 297

Pathways

KEGG:

Cysteine and methionine metabolism
Sulfur metabolism
Metabolic pathways
Sulfur relay system

Reactome:

Degradation of cysteine and homocysteine

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Encephalopathy due to beta-mercaptolactate-cysteine disulfiduria	not provided	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MPST-related disorder	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHIATRIC DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	15495192		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	26022158		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	30500457		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	15495192		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	28291844		★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	28767012		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	25307264		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	16740749, 21104395, 26022559		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	30500457		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	32871814	Associate	★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	15495192		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	29074106, 31382676		★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	38631098	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	16500920	Inhibit	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	36113340, 38631098	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	31734816		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29846174		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	32340322	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	28877979		★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	28877979		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	38631098	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	28291844		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	28291844		★☆☆☆☆ Found in Text Mining only
Hypersensitivity Delayed	Hypersensitivity	Pubtator	19901083	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	29846174		★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	BEFREE	30825200		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29607163		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	29793450		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	29793450	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	31589170		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	18575748		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	16740749, 21104395, 26022559		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	30969006		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	30072378		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26022559, 27221886, 30500457		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	29074106, 31382676		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	CTD_human_DG	25205294		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	37892173, 38070581	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mesothelioma	Mesothelioma	BEFREE	23128478		★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	28487647		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	32340322	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	31029779		★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE SYNDROME, TRANSIENT	Myeloproliferative disorder	BEFREE	26451068, 30644090		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16740749, 27341628, 28197608, 28520570		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	28291844		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	28291844	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	33296712	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	29507650		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	28877979		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	9767613		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	29978257		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	25307264		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	30072378		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	28767012, 30053860, 31203176		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	15495192		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	30093562		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	25077524		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	28877979		★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	9668102		★☆☆☆☆ Found in Text Mining only