Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	4340
Gene name	Myelin oligodendrocyte glycoprotein
Gene symbol	MOG
Synonyms (NCBI Gene)	BTN6BTNL11MOGIG2NRCLP7
Chromosome	6
Chromosome location	6p22.1
Summary	The product of this gene is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a primary target antigen involved in immune-mediated demyelination. This protein may

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs387906655	C>G	Pathogenic	Missense variant, coding sequence variant, intron variant

180

Show/Hide all (180)

miRTarBase ID	miRNA	Experiments	Reference
MIRT684185	hsa-miR-6890-3p	HITS-CLIP	23313552
MIRT684184	hsa-miR-6736-3p	HITS-CLIP	23313552
MIRT684183	hsa-miR-660-3p	HITS-CLIP	23313552
MIRT684182	hsa-miR-939-3p	HITS-CLIP	23313552
MIRT684181	hsa-miR-6852-5p	HITS-CLIP	23313552
MIRT684180	hsa-miR-6742-3p	HITS-CLIP	23313552
MIRT684179	hsa-miR-1304-3p	HITS-CLIP	23313552
MIRT684178	hsa-miR-6787-3p	HITS-CLIP	23313552
MIRT684177	hsa-miR-4772-3p	HITS-CLIP	23313552
MIRT684176	hsa-miR-4695-3p	HITS-CLIP	23313552
MIRT684175	hsa-miR-6778-3p	HITS-CLIP	23313552
MIRT684174	hsa-miR-6791-3p	HITS-CLIP	23313552
MIRT684173	hsa-miR-6829-3p	HITS-CLIP	23313552
MIRT684172	hsa-miR-23a-5p	HITS-CLIP	23313552
MIRT684171	hsa-miR-23b-5p	HITS-CLIP	23313552
MIRT684170	hsa-miR-1343-3p	HITS-CLIP	23313552
MIRT684169	hsa-miR-6783-3p	HITS-CLIP	23313552
MIRT684168	hsa-miR-5001-3p	HITS-CLIP	23313552
MIRT684167	hsa-miR-6836-3p	HITS-CLIP	23313552
MIRT684166	hsa-miR-498	HITS-CLIP	23313552
MIRT445538	hsa-miR-4428	PAR-CLIP	22100165
MIRT445536	hsa-miR-3185	PAR-CLIP	22100165
MIRT445538	hsa-miR-4428	PAR-CLIP	22100165
MIRT445537	hsa-miR-5197-3p	PAR-CLIP	22100165
MIRT445536	hsa-miR-3185	PAR-CLIP	22100165
MIRT684185	hsa-miR-6890-3p	HITS-CLIP	23313552
MIRT684184	hsa-miR-6736-3p	HITS-CLIP	23313552
MIRT684183	hsa-miR-660-3p	HITS-CLIP	23313552
MIRT684182	hsa-miR-939-3p	HITS-CLIP	23313552
MIRT684181	hsa-miR-6852-5p	HITS-CLIP	23313552
MIRT684180	hsa-miR-6742-3p	HITS-CLIP	23313552
MIRT684179	hsa-miR-1304-3p	HITS-CLIP	23313552
MIRT684178	hsa-miR-6787-3p	HITS-CLIP	23313552
MIRT684177	hsa-miR-4772-3p	HITS-CLIP	23313552
MIRT684176	hsa-miR-4695-3p	HITS-CLIP	23313552
MIRT684175	hsa-miR-6778-3p	HITS-CLIP	23313552
MIRT684174	hsa-miR-6791-3p	HITS-CLIP	23313552
MIRT684173	hsa-miR-6829-3p	HITS-CLIP	23313552
MIRT684172	hsa-miR-23a-5p	HITS-CLIP	23313552
MIRT684171	hsa-miR-23b-5p	HITS-CLIP	23313552
MIRT684170	hsa-miR-1343-3p	HITS-CLIP	23313552
MIRT684169	hsa-miR-6783-3p	HITS-CLIP	23313552
MIRT684168	hsa-miR-5001-3p	HITS-CLIP	23313552
MIRT684167	hsa-miR-6836-3p	HITS-CLIP	23313552
MIRT684166	hsa-miR-498	HITS-CLIP	23313552
MIRT445538	hsa-miR-4428	PAR-CLIP	22100165
MIRT445536	hsa-miR-3185	PAR-CLIP	22100165
MIRT445538	hsa-miR-4428	PAR-CLIP	22100165
MIRT445537	hsa-miR-5197-3p	PAR-CLIP	22100165
MIRT445536	hsa-miR-3185	PAR-CLIP	22100165
MIRT1155104	hsa-miR-106a	CLIP-seq
MIRT1155105	hsa-miR-106b	CLIP-seq
MIRT1155106	hsa-miR-1200	CLIP-seq
MIRT1155107	hsa-miR-1234	CLIP-seq
MIRT1155108	hsa-miR-130a	CLIP-seq
MIRT1155109	hsa-miR-130b	CLIP-seq
MIRT1155110	hsa-miR-17	CLIP-seq
MIRT1155111	hsa-miR-197	CLIP-seq
MIRT1155112	hsa-miR-19a	CLIP-seq
MIRT1155113	hsa-miR-19b	CLIP-seq
MIRT1155114	hsa-miR-20a	CLIP-seq
MIRT1155115	hsa-miR-20b	CLIP-seq
MIRT1155116	hsa-miR-301a	CLIP-seq
MIRT1155117	hsa-miR-301b	CLIP-seq
MIRT1155118	hsa-miR-3140-5p	CLIP-seq
MIRT1155119	hsa-miR-3187-3p	CLIP-seq
MIRT1155120	hsa-miR-3545-3p	CLIP-seq
MIRT1155121	hsa-miR-3659	CLIP-seq
MIRT1155122	hsa-miR-3663-5p	CLIP-seq
MIRT1155123	hsa-miR-3666	CLIP-seq
MIRT1155124	hsa-miR-4255	CLIP-seq
MIRT1155125	hsa-miR-4295	CLIP-seq
MIRT1155126	hsa-miR-4326	CLIP-seq
MIRT1155127	hsa-miR-4435	CLIP-seq
MIRT1155128	hsa-miR-454	CLIP-seq
MIRT1155129	hsa-miR-4635	CLIP-seq
MIRT1155130	hsa-miR-4680-5p	CLIP-seq
MIRT1155131	hsa-miR-4701-5p	CLIP-seq
MIRT1155132	hsa-miR-4707-3p	CLIP-seq
MIRT1155133	hsa-miR-4716-5p	CLIP-seq
MIRT1155134	hsa-miR-4755-3p	CLIP-seq
MIRT1155135	hsa-miR-4766-5p	CLIP-seq
MIRT1155136	hsa-miR-4781-3p	CLIP-seq
MIRT1155137	hsa-miR-519a	CLIP-seq
MIRT1155138	hsa-miR-519b-3p	CLIP-seq
MIRT1155139	hsa-miR-519c-3p	CLIP-seq
MIRT1155140	hsa-miR-519d	CLIP-seq
MIRT1155141	hsa-miR-548s	CLIP-seq
MIRT1155142	hsa-miR-588	CLIP-seq
MIRT1155143	hsa-miR-759	CLIP-seq
MIRT1155144	hsa-miR-93	CLIP-seq
MIRT1155111	hsa-miR-197	CLIP-seq
MIRT1155145	hsa-miR-3170	CLIP-seq
MIRT1155119	hsa-miR-3187-3p	CLIP-seq
MIRT1155120	hsa-miR-3545-3p	CLIP-seq
MIRT1155122	hsa-miR-3663-5p	CLIP-seq
MIRT1155127	hsa-miR-4435	CLIP-seq
MIRT1155129	hsa-miR-4635	CLIP-seq
MIRT1155130	hsa-miR-4680-5p	CLIP-seq
MIRT1155131	hsa-miR-4701-5p	CLIP-seq
MIRT1155132	hsa-miR-4707-3p	CLIP-seq
MIRT1155133	hsa-miR-4716-5p	CLIP-seq
MIRT1155134	hsa-miR-4755-3p	CLIP-seq
MIRT1155136	hsa-miR-4781-3p	CLIP-seq
MIRT1155146	hsa-miR-4795-3p	CLIP-seq
MIRT1155147	hsa-miR-5096	CLIP-seq
MIRT1155141	hsa-miR-548s	CLIP-seq
MIRT1155142	hsa-miR-588	CLIP-seq
MIRT1155148	hsa-miR-1323	CLIP-seq
MIRT1155111	hsa-miR-197	CLIP-seq
MIRT1155145	hsa-miR-3170	CLIP-seq
MIRT1155119	hsa-miR-3187-3p	CLIP-seq
MIRT1155120	hsa-miR-3545-3p	CLIP-seq
MIRT1155122	hsa-miR-3663-5p	CLIP-seq
MIRT1155149	hsa-miR-3926	CLIP-seq
MIRT1155127	hsa-miR-4435	CLIP-seq
MIRT1155129	hsa-miR-4635	CLIP-seq
MIRT1155130	hsa-miR-4680-5p	CLIP-seq
MIRT1155131	hsa-miR-4701-5p	CLIP-seq
MIRT1155132	hsa-miR-4707-3p	CLIP-seq
MIRT1155133	hsa-miR-4716-5p	CLIP-seq
MIRT1155134	hsa-miR-4755-3p	CLIP-seq
MIRT1155136	hsa-miR-4781-3p	CLIP-seq
MIRT1155147	hsa-miR-5096	CLIP-seq
MIRT1155150	hsa-miR-548o	CLIP-seq
MIRT1155141	hsa-miR-548s	CLIP-seq
MIRT1155142	hsa-miR-588	CLIP-seq
MIRT1155151	hsa-miR-941	CLIP-seq
MIRT1155107	hsa-miR-1234	CLIP-seq
MIRT2044361	hsa-miR-1236	CLIP-seq
MIRT2044362	hsa-miR-1289	CLIP-seq
MIRT2044363	hsa-miR-1343	CLIP-seq
MIRT2044364	hsa-miR-1976	CLIP-seq
MIRT2044365	hsa-miR-2052	CLIP-seq
MIRT2044366	hsa-miR-3155	CLIP-seq
MIRT2044367	hsa-miR-3155b	CLIP-seq
MIRT1155119	hsa-miR-3187-3p	CLIP-seq
MIRT2044368	hsa-miR-3198	CLIP-seq
MIRT1155120	hsa-miR-3545-3p	CLIP-seq
MIRT1155122	hsa-miR-3663-5p	CLIP-seq
MIRT2044369	hsa-miR-4279	CLIP-seq
MIRT2044370	hsa-miR-4294	CLIP-seq
MIRT2044371	hsa-miR-4307	CLIP-seq
MIRT2044372	hsa-miR-4309	CLIP-seq
MIRT2044373	hsa-miR-432	CLIP-seq
MIRT2044374	hsa-miR-4325	CLIP-seq
MIRT1155127	hsa-miR-4435	CLIP-seq
MIRT2044375	hsa-miR-4480	CLIP-seq
MIRT2044376	hsa-miR-450b-5p	CLIP-seq
MIRT1155129	hsa-miR-4635	CLIP-seq
MIRT1155130	hsa-miR-4680-5p	CLIP-seq
MIRT2044377	hsa-miR-4691-5p	CLIP-seq
MIRT1155131	hsa-miR-4701-5p	CLIP-seq
MIRT1155132	hsa-miR-4707-3p	CLIP-seq
MIRT2044378	hsa-miR-4722-3p	CLIP-seq
MIRT1155134	hsa-miR-4755-3p	CLIP-seq
MIRT2044379	hsa-miR-484	CLIP-seq
MIRT2044380	hsa-miR-507	CLIP-seq
MIRT1155141	hsa-miR-548s	CLIP-seq
MIRT2044381	hsa-miR-557	CLIP-seq
MIRT1155142	hsa-miR-588	CLIP-seq
MIRT2044382	hsa-miR-7	CLIP-seq
MIRT2454379	hsa-miR-1203	CLIP-seq
MIRT2044363	hsa-miR-1343	CLIP-seq
MIRT2044364	hsa-miR-1976	CLIP-seq
MIRT2044369	hsa-miR-4279	CLIP-seq
MIRT2044378	hsa-miR-4722-3p	CLIP-seq
MIRT2044363	hsa-miR-1343	CLIP-seq
MIRT2044364	hsa-miR-1976	CLIP-seq
MIRT2044369	hsa-miR-4279	CLIP-seq
MIRT2044378	hsa-miR-4722-3p	CLIP-seq
MIRT2572434	hsa-miR-564	CLIP-seq
MIRT2454379	hsa-miR-1203	CLIP-seq
MIRT2044363	hsa-miR-1343	CLIP-seq
MIRT2044364	hsa-miR-1976	CLIP-seq
MIRT2044369	hsa-miR-4279	CLIP-seq
MIRT2044378	hsa-miR-4722-3p	CLIP-seq
MIRT2685208	hsa-miR-483-3p	CLIP-seq
MIRT2572434	hsa-miR-564	CLIP-seq
MIRT2685209	hsa-miR-668	CLIP-seq

Show/Hide all (12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001618	Function	Virus receptor activity	IEA
GO:0001817	Process	Regulation of cytokine production	IBA
GO:0005102	Function	Signaling receptor binding	IBA
GO:0005515	Function	Protein binding	IPI	32296183, 32814053
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	NAS	8530032
GO:0007155	Process	Cell adhesion	IEA
GO:0007417	Process	Central nervous system development	TAS	1373175
GO:0009897	Component	External side of plasma membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0046718	Process	Symbiont entry into host cell	IEA
GO:0050852	Process	T cell receptor signaling pathway	IBA

MIM	HGNC	e!Ensembl
159465	7197	ENSG00000204655

Q16653

Protein name

Myelin-oligodendrocyte glycoprotein

Protein function

Mediates homophilic cell-cell adhesion (By similarity). Minor component of the myelin sheath. May be involved in completion and/or maintenance of the myelin sheath and in cell-cell communication. ; (Microbial infection) A

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07686	V-set	36 → 145	Immunoglobulin V-set domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Found exclusively in the CNS, where it is localized on the surface of myelin and oligodendrocyte cytoplasmic membranes.

Sequence

MASLSRPSLPSCLCSFLLLLLLQVSSSYAGQFRVIGPRHPIRALVGDEVELPCRISPGKN
ATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFS
DEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGVLVLLAVLPVLLLQITVGLIFLCLQY
RLRGKLRAEIENLHRTFDPHFLRVPCWKITLFVIVPVLGPLVALIICYNWLHRRLAGQFL
EELRNPF

Sequence length

247

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Narcolepsy 7	Pathogenic	rs387906655	RCV000022667	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (30)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMYELINATING DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DENTAL CARIES	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOG-related disorder	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NARCOLEPSY	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NARCOLEPSY TYPE 1	—	Disgenet, Orphanet Disgenet, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NASOPHARYNGEAL NEOPLASM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPTIC NEURITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARALYSIS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMATITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (87)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	11063846, 11525804, 12576235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	31532865		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	24586351	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amnesia, Transient Global	Amnesia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	16670314, 28898256		★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	11353444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	25846779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	11403222, 15557152, 24324591, 27519689, 28828577, 28887429, 29544193, 30212767, 30475082, 30762607, 30894405, 30907249, 31324740, 31641876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	25539505	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Blindness, Monocular	Blindness	BEFREE	30577778		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataplexy	Cataplexy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	31554915	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Central nervous system demyelination	Central Nervous System Demyelination	BEFREE	11403222, 12023317, 29568992, 29623106, 29661538, 30529926, 30780123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	24122483		★★★★★ ★☆☆☆☆ Found in Text Mining only
Clinically Isolated Syndrome, CNS Demyelinating	Demyelinating Diseases	CTD_human_DG	23360710, 23547115		★★★★★ ★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	20871402, 24014878, 28057865, 29521337, 30212767, 30555462, 30576847, 30985371		★★★★★ ★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating Diseases	BEFREE	12355425, 28248700, 28533781, 28840314, 28887429, 28964723, 28987175, 29073350, 29524760, 29554927, 29957392, 30014148, 30048919, 30056361, 30212767 View all (13 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Demyelinating Diseases	Demyelinating Diseases	CTD_human_DG	23360710, 23547115		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Demyelinating Diseases	Demyelinating diseases	Pubtator	29288492, 37370056	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Demyelinating Diseases	Demyelinating diseases	Pubtator	29468668, 32430437, 34725263	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	BEFREE	29867609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslexia	Dyslexia	BEFREE	12610650, 15503566		★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	28533781, 28982346, 29131884, 29414288, 29629942, 29670575, 30133068, 30590238, 30599296, 30907249, 31279093, 31398656, 31492559, 31641876, 31837635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	Pubtator	35990698	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalomyelitis Acute Disseminated	Acute disseminated encephalomyelitis	Pubtator	29468668	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	BEFREE	30221764, 30513201, 31080435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	30448468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Focal cortical dysplasia of Taylor	Focal cortical dysplasia	Pubtator	34301297	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gilles de la Tourette syndrome	Tourette Syndrome	BEFREE	14681920		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	GWASDB_DG	21900946		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hallucinations	Hallucinations	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type II	Hyperlipoproteinemia	Pubtator	28473662	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	29203302		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	31296356, 31324740		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	29695462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukodystrophy	Leukodystrophy	BEFREE	29288492, 29468668		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukoencephalopathy	Leukoencephalopathy	BEFREE	29288492		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	31621483		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	19447584, 25930075, 29477585, 29867609, 30477561		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	BEFREE	29867609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Movement Disorders	Movement Disorders	BEFREE	30379117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	10541588, 11128602, 11164908, 11205153, 11403222, 11525804, 11739534, 12149493, 12355425, 12446029, 12458053, 12663683, 14597095, 14624757, 15039386 View all (90 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	LHGDN	12077287, 14688379, 16900754, 17142321, 17573820, 17928868, 18753473		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	12355425, 16295526, 16295528, 17573820, 21653833, 31228212, 9808202	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	37192682	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	37215118	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	27951522, 29208041		★★★★★ ★☆☆☆☆ Found in Text Mining only
MUTYH-Associate Polyposis	Polyposis	BEFREE	30738572		★★★★★ ★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	BEFREE	17256150, 21907016, 25197808		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Narcolepsy	Narcolepsy	ORPHANET_DG	21907016		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Narcolepsy	Narcolepsy	Pubtator	25197808	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Narcolepsy	Narcolepsy	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Narcolepsy	Narcolepsy	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NARCOLEPSY 7	Narcolepsy	GENOMICS_ENGLAND_DG	21907016		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
NARCOLEPSY 7	Narcolepsy	UNIPROT_DG	21907016		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
NARCOLEPSY 7	Narcolepsy	CLINVAR_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Narcolepsy type 1	Narcolepsy	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Narcolepsy-Cataplexy Syndrome	Narcolepsy-Cataplexy Syndrome	BEFREE	21907016		★★★★★ ★☆☆☆☆ Found in Text Mining only
Narcolepsy-Cataplexy Syndrome	Narcolepsy-Cataplexy Syndrome	ORPHANET_DG	21907016		★★★★★ ★☆☆☆☆ Found in Text Mining only
Narcolepsy-Cataplexy Syndrome	Narcolepsy-Cataplexy Syndrome	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	28561044		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	10408984, 29288492, 29875186, 30559466		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	24586351	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	24586351, 31057084		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuromyelitis Optica	Neuromyelitis Optica	BEFREE	23707078, 24014878, 27788675, 27793206, 27844165, 27885065, 27951522, 28005176, 28248700, 28306572, 28364548, 28533781, 28615429, 28646890, 28684532 View all (63 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuropsychiatric Systemic Lupus Erythematosus	Neuropsychiatric Systemic Lupus Erythematosus	BEFREE	29073350		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Obsessive-Compulsive Disorder	Obsessive-Compulsive Disorder	BEFREE	15274043, 20452030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Atrophy	Optic Atrophy	BEFREE	31532865		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Neuritis	Optic Neuritis	BEFREE	24014878, 27788675, 27793206, 28248700, 28477397, 28533781, 28684532, 28980518, 28991690, 29055448, 29101456, 29142145, 29363529, 29470571, 29571858 View all (32 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Optic Neuritis	Optic neuritis	Pubtator	24415568, 28125740, 30055153, 30825703, 34272440, 36969199	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Optic Neuropathy	Optic Neuropathy	BEFREE	29716788, 30281030, 30514710		★★★★★ ★☆☆☆☆ Found in Text Mining only
Painful Bladder Syndrome	Interstitial cystitis	BEFREE	31484369		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	29938337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papilledema	Papilledema	BEFREE	30281030, 31582363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	24586351		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pleocytosis	CSF pleocytosis	BEFREE	31276911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prune Belly Syndrome	Prune belly syndrome	BEFREE	31484369		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pseudotumor Cerebri	intracranial hypertension	BEFREE	28733756, 29938337, 30300850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pustular psoriasis	Pustular Psoriasis	BEFREE	30219743		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	20967861, 28656478		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	15653272, 15660663, 17223013, 22675524, 29564992		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	15653272, 15660663, 22675524		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	19034380, 19165527		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	22675524, 25539505	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveitis	Uveitis	BEFREE	30748058		★★★★★ ★☆☆☆☆ Found in Text Mining only

MOG (myelin oligodendrocyte glycoprotein)