Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	4327
Gene name	Matrix metallopeptidase 19
Gene symbol	MMP19
Synonyms (NCBI Gene)	CODAMMP18RASI-1
Chromosome	12
Chromosome location	12q13.2
Summary	This gene encodes a member of a family of proteins that are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as a

186

Show/Hide all (186)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023166	hsa-miR-124-3p	Microarray	18668037
MIRT735022	hsa-miR-4270	Luciferase reporter assayWestern blottingqRT-PCRFlow cytometry	33024586
MIRT1153348	hsa-miR-1256	CLIP-seq
MIRT1153349	hsa-miR-1278	CLIP-seq
MIRT1153350	hsa-miR-200b	CLIP-seq
MIRT1153351	hsa-miR-200c	CLIP-seq
MIRT1153352	hsa-miR-3663-5p	CLIP-seq
MIRT1153353	hsa-miR-429	CLIP-seq
MIRT1153354	hsa-miR-4441	CLIP-seq
MIRT1153355	hsa-miR-4724-5p	CLIP-seq
MIRT2043915	hsa-miR-4653-3p	CLIP-seq
MIRT2043916	hsa-miR-4678	CLIP-seq
MIRT2273263	hsa-miR-106a	CLIP-seq
MIRT2273264	hsa-miR-106b	CLIP-seq
MIRT2273265	hsa-miR-1245	CLIP-seq
MIRT2273266	hsa-miR-1343	CLIP-seq
MIRT2273267	hsa-miR-150	CLIP-seq
MIRT2273268	hsa-miR-17	CLIP-seq
MIRT2273269	hsa-miR-1976	CLIP-seq
MIRT2273270	hsa-miR-20a	CLIP-seq
MIRT2273271	hsa-miR-20b	CLIP-seq
MIRT2273272	hsa-miR-302a	CLIP-seq
MIRT2273273	hsa-miR-302b	CLIP-seq
MIRT2273274	hsa-miR-302c	CLIP-seq
MIRT2273275	hsa-miR-302d	CLIP-seq
MIRT2273276	hsa-miR-302e	CLIP-seq
MIRT2273277	hsa-miR-3130-3p	CLIP-seq
MIRT2273278	hsa-miR-3157-5p	CLIP-seq
MIRT2273279	hsa-miR-3159	CLIP-seq
MIRT2273280	hsa-miR-3545-3p	CLIP-seq
MIRT2273281	hsa-miR-3651	CLIP-seq
MIRT2273282	hsa-miR-370	CLIP-seq
MIRT2273283	hsa-miR-372	CLIP-seq
MIRT2273284	hsa-miR-373	CLIP-seq
MIRT2273285	hsa-miR-378g	CLIP-seq
MIRT2273286	hsa-miR-3977	CLIP-seq
MIRT2273287	hsa-miR-4300	CLIP-seq
MIRT2273288	hsa-miR-4437	CLIP-seq
MIRT2273289	hsa-miR-4674	CLIP-seq
MIRT2273290	hsa-miR-4680-5p	CLIP-seq
MIRT2273291	hsa-miR-4768-5p	CLIP-seq
MIRT2273292	hsa-miR-4793-3p	CLIP-seq
MIRT2273293	hsa-miR-519d	CLIP-seq
MIRT2273294	hsa-miR-520a-3p	CLIP-seq
MIRT2273295	hsa-miR-520b	CLIP-seq
MIRT2273296	hsa-miR-520c-3p	CLIP-seq
MIRT2273297	hsa-miR-520d-3p	CLIP-seq
MIRT2273298	hsa-miR-520e	CLIP-seq
MIRT2273299	hsa-miR-520g	CLIP-seq
MIRT2273300	hsa-miR-520h	CLIP-seq
MIRT2273301	hsa-miR-920	CLIP-seq
MIRT2273302	hsa-miR-93	CLIP-seq
MIRT2390980	hsa-miR-942	CLIP-seq
MIRT2454280	hsa-miR-1236	CLIP-seq
MIRT2454281	hsa-miR-1321	CLIP-seq
MIRT2454282	hsa-miR-28-5p	CLIP-seq
MIRT2454283	hsa-miR-3139	CLIP-seq
MIRT2454284	hsa-miR-3150b-3p	CLIP-seq
MIRT2454285	hsa-miR-3154	CLIP-seq
MIRT2454286	hsa-miR-3185	CLIP-seq
MIRT2454287	hsa-miR-345	CLIP-seq
MIRT2454288	hsa-miR-3679-3p	CLIP-seq
MIRT2454289	hsa-miR-3921	CLIP-seq
MIRT2273287	hsa-miR-4300	CLIP-seq
MIRT2454290	hsa-miR-4419a	CLIP-seq
MIRT2454291	hsa-miR-4510	CLIP-seq
MIRT2454292	hsa-miR-4649-3p	CLIP-seq
MIRT2454293	hsa-miR-4653-5p	CLIP-seq
MIRT2454294	hsa-miR-4689	CLIP-seq
MIRT2454295	hsa-miR-4728-5p	CLIP-seq
MIRT2454296	hsa-miR-4739	CLIP-seq
MIRT2454297	hsa-miR-4747-5p	CLIP-seq
MIRT2454298	hsa-miR-4756-5p	CLIP-seq
MIRT2454299	hsa-miR-4784	CLIP-seq
MIRT2454300	hsa-miR-618	CLIP-seq
MIRT2454301	hsa-miR-660	CLIP-seq
MIRT2454302	hsa-miR-708	CLIP-seq
MIRT2454303	hsa-miR-760	CLIP-seq
MIRT2273301	hsa-miR-920	CLIP-seq
MIRT2454281	hsa-miR-1321	CLIP-seq
MIRT2273287	hsa-miR-4300	CLIP-seq
MIRT2454290	hsa-miR-4419a	CLIP-seq
MIRT2454291	hsa-miR-4510	CLIP-seq
MIRT2454295	hsa-miR-4728-5p	CLIP-seq
MIRT2454296	hsa-miR-4739	CLIP-seq
MIRT2454298	hsa-miR-4756-5p	CLIP-seq
MIRT2273301	hsa-miR-920	CLIP-seq
MIRT2572064	hsa-miR-1266	CLIP-seq
MIRT2572065	hsa-miR-1275	CLIP-seq
MIRT2454281	hsa-miR-1321	CLIP-seq
MIRT2572066	hsa-miR-1324	CLIP-seq
MIRT2454285	hsa-miR-3154	CLIP-seq
MIRT2454286	hsa-miR-3185	CLIP-seq
MIRT2572067	hsa-miR-3200-5p	CLIP-seq
MIRT2572068	hsa-miR-3202	CLIP-seq
MIRT2572069	hsa-miR-3617	CLIP-seq
MIRT2572070	hsa-miR-3647-3p	CLIP-seq
MIRT2572071	hsa-miR-3664-3p	CLIP-seq
MIRT2572072	hsa-miR-3922-5p	CLIP-seq
MIRT2572073	hsa-miR-3926	CLIP-seq
MIRT2572074	hsa-miR-4259	CLIP-seq
MIRT2572075	hsa-miR-4278	CLIP-seq
MIRT2273287	hsa-miR-4300	CLIP-seq
MIRT2454290	hsa-miR-4419a	CLIP-seq
MIRT2572076	hsa-miR-4424	CLIP-seq
MIRT2572077	hsa-miR-4433	CLIP-seq
MIRT2572078	hsa-miR-4446-3p	CLIP-seq
MIRT2572079	hsa-miR-4459	CLIP-seq
MIRT2572080	hsa-miR-4488	CLIP-seq
MIRT2454291	hsa-miR-4510	CLIP-seq
MIRT2572081	hsa-miR-4518	CLIP-seq
MIRT2572082	hsa-miR-4533	CLIP-seq
MIRT2043915	hsa-miR-4653-3p	CLIP-seq
MIRT2572083	hsa-miR-4665-5p	CLIP-seq
MIRT2572084	hsa-miR-4675	CLIP-seq
MIRT2572085	hsa-miR-4682	CLIP-seq
MIRT2572086	hsa-miR-4694-3p	CLIP-seq
MIRT2572087	hsa-miR-4697-5p	CLIP-seq
MIRT2454295	hsa-miR-4728-5p	CLIP-seq
MIRT2454296	hsa-miR-4739	CLIP-seq
MIRT2572088	hsa-miR-4741	CLIP-seq
MIRT2454297	hsa-miR-4747-5p	CLIP-seq
MIRT2454298	hsa-miR-4756-5p	CLIP-seq
MIRT2572089	hsa-miR-4762-5p	CLIP-seq
MIRT2572090	hsa-miR-4768-3p	CLIP-seq
MIRT2572091	hsa-miR-513c	CLIP-seq
MIRT2572092	hsa-miR-514b-5p	CLIP-seq
MIRT2572093	hsa-miR-571	CLIP-seq
MIRT2572094	hsa-miR-626	CLIP-seq
MIRT2572095	hsa-miR-641	CLIP-seq
MIRT2572096	hsa-miR-642b	CLIP-seq
MIRT2454303	hsa-miR-760	CLIP-seq
MIRT2273301	hsa-miR-920	CLIP-seq
MIRT2572097	hsa-miR-939	CLIP-seq
MIRT2572064	hsa-miR-1266	CLIP-seq
MIRT2572065	hsa-miR-1275	CLIP-seq
MIRT2454281	hsa-miR-1321	CLIP-seq
MIRT2572066	hsa-miR-1324	CLIP-seq
MIRT2685135	hsa-miR-205	CLIP-seq
MIRT2454284	hsa-miR-3150b-3p	CLIP-seq
MIRT2454285	hsa-miR-3154	CLIP-seq
MIRT2454286	hsa-miR-3185	CLIP-seq
MIRT2572067	hsa-miR-3200-5p	CLIP-seq
MIRT2572068	hsa-miR-3202	CLIP-seq
MIRT2572069	hsa-miR-3617	CLIP-seq
MIRT2572071	hsa-miR-3664-3p	CLIP-seq
MIRT2454289	hsa-miR-3921	CLIP-seq
MIRT2572073	hsa-miR-3926	CLIP-seq
MIRT2572074	hsa-miR-4259	CLIP-seq
MIRT2572075	hsa-miR-4278	CLIP-seq
MIRT2273287	hsa-miR-4300	CLIP-seq
MIRT2454290	hsa-miR-4419a	CLIP-seq
MIRT2572076	hsa-miR-4424	CLIP-seq
MIRT2572077	hsa-miR-4433	CLIP-seq
MIRT2572078	hsa-miR-4446-3p	CLIP-seq
MIRT2572079	hsa-miR-4459	CLIP-seq
MIRT2572080	hsa-miR-4488	CLIP-seq
MIRT2454291	hsa-miR-4510	CLIP-seq
MIRT2572081	hsa-miR-4518	CLIP-seq
MIRT2572082	hsa-miR-4533	CLIP-seq
MIRT2685136	hsa-miR-4645-5p	CLIP-seq
MIRT2454292	hsa-miR-4649-3p	CLIP-seq
MIRT2043915	hsa-miR-4653-3p	CLIP-seq
MIRT2454293	hsa-miR-4653-5p	CLIP-seq
MIRT2572083	hsa-miR-4665-5p	CLIP-seq
MIRT2685137	hsa-miR-4673	CLIP-seq
MIRT2572084	hsa-miR-4675	CLIP-seq
MIRT2572085	hsa-miR-4682	CLIP-seq
MIRT2454294	hsa-miR-4689	CLIP-seq
MIRT2572086	hsa-miR-4694-3p	CLIP-seq
MIRT2572087	hsa-miR-4697-5p	CLIP-seq
MIRT2454295	hsa-miR-4728-5p	CLIP-seq
MIRT2454296	hsa-miR-4739	CLIP-seq
MIRT2572088	hsa-miR-4741	CLIP-seq
MIRT2454297	hsa-miR-4747-5p	CLIP-seq
MIRT2454298	hsa-miR-4756-5p	CLIP-seq
MIRT2572089	hsa-miR-4762-5p	CLIP-seq
MIRT2572090	hsa-miR-4768-3p	CLIP-seq
MIRT2454299	hsa-miR-4784	CLIP-seq
MIRT2572093	hsa-miR-571	CLIP-seq
MIRT2572094	hsa-miR-626	CLIP-seq
MIRT2572095	hsa-miR-641	CLIP-seq
MIRT2572096	hsa-miR-642b	CLIP-seq
MIRT2454303	hsa-miR-760	CLIP-seq
MIRT2273301	hsa-miR-920	CLIP-seq
MIRT2572097	hsa-miR-939	CLIP-seq

Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0001541	Process	Ovarian follicle development	IEA
GO:0001542	Process	Ovulation from ovarian follicle	IEA
GO:0001554	Process	Luteolysis	IEA
GO:0004222	Function	Metalloendopeptidase activity	EXP	10809722
GO:0004222	Function	Metalloendopeptidase activity	IBA
GO:0004222	Function	Metalloendopeptidase activity	IEA
GO:0004222	Function	Metalloendopeptidase activity	TAS
GO:0004252	Function	Serine-type endopeptidase activity	TAS
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0006508	Process	Proteolysis	IEA
GO:0006508	Process	Proteolysis	NAS	9020145
GO:0008233	Function	Peptidase activity	IEA
GO:0008237	Function	Metallopeptidase activity	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0009725	Process	Response to hormone	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0022617	Process	Extracellular matrix disassembly	TAS
GO:0030154	Process	Cell differentiation	IEA
GO:0030198	Process	Extracellular matrix organization	IBA
GO:0030574	Process	Collagen catabolic process	IBA
GO:0030574	Process	Collagen catabolic process	IEA
GO:0031012	Component	Extracellular matrix	IEA
GO:0031012	Component	Extracellular matrix	NAS	10809722
GO:0046872	Function	Metal ion binding	IEA
GO:0051591	Process	Response to cAMP	IEA

MIM	HGNC	e!Ensembl
601807	7165	ENSG00000123342

Q99542

Protein name

Matrix metalloproteinase-19 (MMP-19) (EC 3.4.24.-) (Matrix metalloproteinase RASI) (Matrix metalloproteinase-18) (MMP-18)

Protein function

Endopeptidase that degrades various components of the extracellular matrix, such as aggrecan and cartilage oligomeric matrix protein (comp), during development, haemostasis and pathological conditions (arthritic disease). May also play a role in

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01471	PG_binding_1	29 → 80	Putative peptidoglycan binding domain	Domain
PF00413	Peptidase_M10	103 → 256	Matrixin	Domain
PF00045	Hemopexin	337 → 377	Hemopexin	Repeat
PF00045	Hemopexin	380 → 427	Hemopexin	Repeat
PF00045	Hemopexin	429 → 472	Hemopexin	Repeat

Tissue specificity

TISSUE SPECIFICITY: Expressed in mammary gland, placenta, lung, pancreas, ovary, small intestine, spleen, thymus, prostate, testis colon, heart and blood vessel walls. Not detected in brain and peripheral blood leukocytes. Also expressed in the synovial f

Sequence

MNCQQLWLGFLLPMTVSGRVLGLAEVAPVDYLSQYGYLQKPLEGSNNFKPEDITEALRAF
QEASELPVSGQLDDATRARMRQPRCGLEDPFNQKTLKYLLLGRWRKKHLTFRILNLPSTL
PPHTARAALRQAFQDWSNVAPLTFQEVQAGAADIRLSFHGRQSSYCSNTFDGPGRVLAHA
DIPELGSVHFDEDEFWTEGTYRGVNLRIIAAHEVGHALGLGHSRYSQALMAPVYEGYRPH
FKLHPDDVAGIQALYGKKSPVIRDEEEEETELPTVPPVPTEPSPMPDPCSSELDAMMLGP
RGKTYAFKGDYVWTVSDSGPGPLFRVSALWEGLPGNLDAAVYSPRTQWIHFFKGDKVWRY
INFKMSPGFPKKLNRVEPNLDAALYWPLNQKVFLFKGSGYWQWDELARTDFSSYPKPIKG
LFTGVPNQPSAAMSWQDGRVYFFKGKVYWRLNQQLRVEKGYPRNISHNWMHCRPRTIDTT
PSGGNTTPSGTGITLDTTLSATETTFEY

Sequence length

508

Interactions

View interactions

	Reactome
			Degradation of the extracellular matrix

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (10)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CAVITARY OPTIC DISC ANOMALIES	—	CTD, Disgenet, HPO CTD, Disgenet, HPO CTD, Disgenet, HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cavitary optic disk anomaly	Uncertain significance; Benign; Conflicting classifications of pathogenicity; Likely benign	ClinVar ClinVar, GenCC	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Gastric cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Interstitial lung disease 2	Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Lung cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MMP19-related disorder	Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (61)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	LHGDN	15239678		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	12516088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aneurysm	Aneurysm	Pubtator	21955474	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	12735638	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthropathy	Arthropathy	BEFREE	9232430		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	19843707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	20142769		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19531263	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23568046	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	22576687	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	25250855		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	34177903	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	31406154		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cavitary Optic Disc Anomalies	Cavitary Optic Disc Anomalies	ORPHANET_DG	25581579		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cavitary Optic Disc Anomalies	Cavitary optic disc anomalies	Pubtator	25581579, 28003733	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cavitary Optic Disc Anomalies	Cavitary Optic Disc Anomalies	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chondrosarcoma	Chondrosarcoma	Pubtator	18641983	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	18641983	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	31196659		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	26555704		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	22576687	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31088409		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22576687, 31088409, 35352707	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	29323744, 9232430		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	Pubtator	14708597	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Primary Pulmonary Hypertension	Pulmonary hypertension	Pubtator	25840998	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	26292259		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	25056434	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	20142769		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	20142769		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	22859522		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	26555704		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	35352707	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	29578401		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	25250855		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	25250855	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	31088409	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	17980449		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	25250855		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	31406154		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	12516088, 15169894		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12516088, 15169894, 18651563, 22576687		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Squamous Cell Neoplasm	Neoplasm	BEFREE	16699496		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	20098411	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	20098411	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	CTD_human_DG	18539642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	14708597	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	12517806, 21165953, 23956056		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	23956056	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17980449, 20142769, 21165953, 22902510, 25250855		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	25250855		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	15169894		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	31406154		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	31406154	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	12735638, 14708597	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	14708597		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	22859522		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10388526, 15169894, 9232430, 9562866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	LHGDN	12516088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	15169894		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	18161657		★★★★★ ★☆☆☆☆ Found in Text Mining only

MMP19 (matrix metallopeptidase 19)