Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	4326
Gene name	Matrix metallopeptidase 17
Gene symbol	MMP17
Synonyms (NCBI Gene)	MMP-17MT4-MMPMT4MMPMTMMP4
Chromosome	12
Chromosome location	12q24.33
Summary	This gene encodes a member of the peptidase M10 family and membrane-type subfamily of matrix metalloproteinases (MMPs). Proteins in this family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic deve

Show/Hide all (82)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018145	hsa-miR-335-5p	Microarray	18185580
MIRT690004	hsa-miR-4293	HITS-CLIP	23313552
MIRT690003	hsa-miR-4728-3p	HITS-CLIP	23313552
MIRT690002	hsa-miR-3622a-3p	HITS-CLIP	23313552
MIRT690001	hsa-miR-3622b-3p	HITS-CLIP	23313552
MIRT690000	hsa-miR-6765-3p	HITS-CLIP	23313552
MIRT689999	hsa-miR-4768-3p	HITS-CLIP	23313552
MIRT689998	hsa-miR-4459	HITS-CLIP	23313552
MIRT689997	hsa-miR-4433a-3p	HITS-CLIP	23313552
MIRT689996	hsa-miR-6849-3p	HITS-CLIP	23313552
MIRT689995	hsa-miR-544b	HITS-CLIP	23313552
MIRT689994	hsa-miR-7162-3p	HITS-CLIP	23313552
MIRT689993	hsa-miR-4786-5p	HITS-CLIP	23313552
MIRT573519	hsa-miR-6805-5p	PAR-CLIP	20371350
MIRT573520	hsa-miR-5707	PAR-CLIP	20371350
MIRT573518	hsa-miR-3184-5p	PAR-CLIP	20371350
MIRT573517	hsa-miR-423-5p	PAR-CLIP	20371350
MIRT573516	hsa-miR-1914-3p	PAR-CLIP	20371350
MIRT573515	hsa-miR-5194	PAR-CLIP	20371350
MIRT573513	hsa-miR-6738-5p	PAR-CLIP	20371350
MIRT573514	hsa-miR-4290	PAR-CLIP	20371350
MIRT573512	hsa-miR-6834-5p	PAR-CLIP	20371350
MIRT573511	hsa-miR-1226-5p	PAR-CLIP	20371350
MIRT573510	hsa-miR-6734-5p	PAR-CLIP	20371350
MIRT573509	hsa-miR-1304-5p	PAR-CLIP	20371350
MIRT690004	hsa-miR-4293	HITS-CLIP	23313552
MIRT690003	hsa-miR-4728-3p	HITS-CLIP	23313552
MIRT690002	hsa-miR-3622a-3p	HITS-CLIP	23313552
MIRT690001	hsa-miR-3622b-3p	HITS-CLIP	23313552
MIRT690000	hsa-miR-6765-3p	HITS-CLIP	23313552
MIRT689999	hsa-miR-4768-3p	HITS-CLIP	23313552
MIRT689998	hsa-miR-4459	HITS-CLIP	23313552
MIRT689997	hsa-miR-4433a-3p	HITS-CLIP	23313552
MIRT689996	hsa-miR-6849-3p	HITS-CLIP	23313552
MIRT689995	hsa-miR-544b	HITS-CLIP	23313552
MIRT689994	hsa-miR-7162-3p	HITS-CLIP	23313552
MIRT689993	hsa-miR-4786-5p	HITS-CLIP	23313552
MIRT573519	hsa-miR-6805-5p	PAR-CLIP	20371350
MIRT573520	hsa-miR-5707	PAR-CLIP	20371350
MIRT573518	hsa-miR-3184-5p	PAR-CLIP	20371350
MIRT573517	hsa-miR-423-5p	PAR-CLIP	20371350
MIRT573516	hsa-miR-1914-3p	PAR-CLIP	20371350
MIRT573515	hsa-miR-5194	PAR-CLIP	20371350
MIRT573513	hsa-miR-6738-5p	PAR-CLIP	20371350
MIRT573514	hsa-miR-4290	PAR-CLIP	20371350
MIRT573512	hsa-miR-6834-5p	PAR-CLIP	20371350
MIRT573511	hsa-miR-1226-5p	PAR-CLIP	20371350
MIRT573510	hsa-miR-6734-5p	PAR-CLIP	20371350
MIRT573509	hsa-miR-1304-5p	PAR-CLIP	20371350
MIRT1153323	hsa-miR-1293	CLIP-seq
MIRT1153324	hsa-miR-29a	CLIP-seq
MIRT1153325	hsa-miR-29b	CLIP-seq
MIRT1153326	hsa-miR-29c	CLIP-seq
MIRT1153327	hsa-miR-3170	CLIP-seq
MIRT1153328	hsa-miR-3663-3p	CLIP-seq
MIRT1153329	hsa-miR-3960	CLIP-seq
MIRT1153330	hsa-miR-4265	CLIP-seq
MIRT1153331	hsa-miR-4296	CLIP-seq
MIRT1153332	hsa-miR-4302	CLIP-seq
MIRT1153333	hsa-miR-4322	CLIP-seq
MIRT1153334	hsa-miR-4417	CLIP-seq
MIRT1153335	hsa-miR-4467	CLIP-seq
MIRT1153336	hsa-miR-4483	CLIP-seq
MIRT1153337	hsa-miR-4514	CLIP-seq
MIRT1153338	hsa-miR-4519	CLIP-seq
MIRT1153339	hsa-miR-4645-5p	CLIP-seq
MIRT1153340	hsa-miR-4673	CLIP-seq
MIRT1153341	hsa-miR-4692	CLIP-seq
MIRT1153342	hsa-miR-4695-5p	CLIP-seq
MIRT1153343	hsa-miR-4733-3p	CLIP-seq
MIRT1153344	hsa-miR-4743	CLIP-seq
MIRT1153345	hsa-miR-4746-3p	CLIP-seq
MIRT1153346	hsa-miR-485-5p	CLIP-seq
MIRT1153347	hsa-miR-765	CLIP-seq
MIRT2043912	hsa-miR-1910	CLIP-seq
MIRT1153327	hsa-miR-3170	CLIP-seq
MIRT2043913	hsa-miR-3195	CLIP-seq
MIRT2043914	hsa-miR-566	CLIP-seq
MIRT2273259	hsa-miR-1299	CLIP-seq
MIRT2273260	hsa-miR-4527	CLIP-seq
MIRT2273261	hsa-miR-4781-3p	CLIP-seq
MIRT2273262	hsa-miR-875-3p	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
SNAI2	Unknown	20019845

Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001822	Process	Kidney development	IEA
GO:0004222	Function	Metalloendopeptidase activity	IBA
GO:0004222	Function	Metalloendopeptidase activity	IEA
GO:0004222	Function	Metalloendopeptidase activity	TAS	8640782
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0006508	Process	Proteolysis	IEA
GO:0006508	Process	Proteolysis	TAS	14645246
GO:0008047	Function	Enzyme activator activity	TAS	8640782
GO:0008233	Function	Peptidase activity	IEA
GO:0008237	Function	Metallopeptidase activity	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008270	Function	Zinc ion binding	TAS	8640782
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0030198	Process	Extracellular matrix organization	IBA
GO:0030574	Process	Collagen catabolic process	IBA
GO:0031012	Component	Extracellular matrix	IEA
GO:0042756	Process	Drinking behavior	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0070006	Function	Metalloaminopeptidase activity	TAS	14645246
GO:0098552	Component	Side of membrane	IEA

MIM	HGNC	e!Ensembl
602285	7163	ENSG00000198598

Q9ULZ9

Protein name

Matrix metalloproteinase-17 (MMP-17) (EC 3.4.24.-) (Membrane-type matrix metalloproteinase 4) (MT-MMP 4) (MTMMP4) (Membrane-type-4 matrix metalloproteinase) (MT4-MMP) (MT4MMP)

Protein function

Endopeptidase that degrades various components of the extracellular matrix, such as fibrin. May be involved in the activation of membrane-bound precursors of growth factors or inflammatory mediators, such as tumor necrosis factor-alpha. May also

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01471	PG_binding_1	45 → 105	Putative peptidoglycan binding domain	Domain
PF00413	Peptidase_M10	132 → 295	Matrixin	Domain
PF00045	Hemopexin	336 → 379	Hemopexin	Repeat
PF00045	Hemopexin	385 → 428	Hemopexin	Repeat
PF00045	Hemopexin	431 → 477	Hemopexin	Repeat
PF00045	Hemopexin	479 → 523	Hemopexin	Repeat

Tissue specificity

TISSUE SPECIFICITY: Expressed in brain, leukocytes, colon, ovary testis and breast cancer. Expressed also in many transformed and non-transformed cell types.

Sequence

MRRRAARGPGPPPPGPGLSRLPLPLLLLLALGTRGGCAAPAPAPRAEDLSLGVEWLSRFG
YLPPADPTTGQLQTQEELSKAITAMQQFGGLEATGILDEATLALMKTPRCSLPDLPVLTQ
ARRRRQAPAPTKWNKRNLSWRVRTFPRDSPLGHDTVRALMYYALKVWSDIAPLNFHEVAG
SAADIQIDFSKADHNDGYPFDGPGGTVAHAFFPGHHHTAGDTHFDDDEAWTFRSSDAHGM
DLFAVAVHEFGHAIGLSHVAAAHSIMRPYYQGPVGDPLRYGLPYEDKVRVWQLYGVRESV
SPTAQPEEPPLLPEPPDNRSSAPPRKDVPHRCSTHFDAVAQIRGEAFFFKGKYFWRLTRD
RHLVSLQPAQMHRFWRGLPLHLDSVDAVYERTSDHKIVFFKGDRYWVFKDNNVEEGYPRP
VSDFSLPPGGIDAAFSWAHNDRTYFFKDQLYWRYDDHTRHMDPGYPAQSPLWRGVPSTLD
DAMRWSDGASYFFRGQEYWKVLDGELEVAPGYPQSTARDWLVCGDSQADGSVAAGVDAAE
GPRAPPGQHDQSRSEDGYEVCSCTSGASSPPGAPGPLVAATMLLLLPPLSPGALWTAAQA
LTL

Sequence length

603

Interactions

View interactions

	KEGG		Reactome
	Parathyroid hormone synthesis, secretion and action		Activation of Matrix Metalloproteinases

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
MIGRAINE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (32)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	16707440		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	25963716		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	29500407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	10857781, 29393373, 30654475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10857781	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	29500407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	BEFREE	16707440, 22262494		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	16707440, 28196064, 30654475, 30792164, 8640782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	16707440, 22262494	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	36042626	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	36042626	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	38357816	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	20019845		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	37770592	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	16707440	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	20019845		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	16707440, 28196064, 30654475, 30792164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10471807, 18286480, 20019845, 28531887, 30504427, 31813546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	8640782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	28531887, 36373310	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	GWASDB_DG	22683712		★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	GWASCAT_DG	22683712		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	38357816	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16010555, 16707440, 22262494, 28196064, 30654475, 30792164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	29393373		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	36042626, 37434173	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	39796177	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10857781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	31813546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	28196064, 30504427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	34587931	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	38357816	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

MMP17 (matrix metallopeptidase 17)