Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	4324
Gene name	Matrix metallopeptidase 15
Gene symbol	MMP15
Synonyms (NCBI Gene)	MMP-15MT2-MMPMT2MMPMTMMP2SMCP-2
Chromosome	16
Chromosome location	16q21
Summary	This gene encodes a member of the peptidase M10 family and membrane-type subfamily of matrix metalloproteinases (MMPs). Proteins in this family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic deve

178

Show/Hide all (178)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005383	hsa-miR-29b-3p	Luciferase reporter assayqRT-PCR	21305051
MIRT005384	hsa-miR-29c-3p	Luciferase reporter assayqRT-PCR	21305051
MIRT448066	hsa-miR-4476	PAR-CLIP	22100165
MIRT448064	hsa-miR-6876-5p	PAR-CLIP	22100165
MIRT448063	hsa-miR-3158-3p	PAR-CLIP	22100165
MIRT448062	hsa-miR-3921	PAR-CLIP	22100165
MIRT448061	hsa-miR-4653-5p	PAR-CLIP	22100165
MIRT448060	hsa-miR-4649-3p	PAR-CLIP	22100165
MIRT448059	hsa-miR-7162-3p	PAR-CLIP	22100165
MIRT448057	hsa-miR-3928-3p	PAR-CLIP	22100165
MIRT448058	hsa-miR-3202	PAR-CLIP	22100165
MIRT448056	hsa-miR-6822-3p	PAR-CLIP	22100165
MIRT448055	hsa-miR-760	PAR-CLIP	22100165
MIRT448054	hsa-miR-3915	PAR-CLIP	22100165
MIRT448053	hsa-miR-8057	PAR-CLIP	22100165
MIRT448066	hsa-miR-4476	PAR-CLIP	22100165
MIRT448064	hsa-miR-6876-5p	PAR-CLIP	22100165
MIRT448063	hsa-miR-3158-3p	PAR-CLIP	22100165
MIRT448062	hsa-miR-3921	PAR-CLIP	22100165
MIRT448061	hsa-miR-4653-5p	PAR-CLIP	22100165
MIRT448060	hsa-miR-4649-3p	PAR-CLIP	22100165
MIRT448059	hsa-miR-7162-3p	PAR-CLIP	22100165
MIRT448057	hsa-miR-3928-3p	PAR-CLIP	22100165
MIRT448058	hsa-miR-3202	PAR-CLIP	22100165
MIRT448056	hsa-miR-6822-3p	PAR-CLIP	22100165
MIRT448055	hsa-miR-760	PAR-CLIP	22100165
MIRT448054	hsa-miR-3915	PAR-CLIP	22100165
MIRT448053	hsa-miR-8057	PAR-CLIP	22100165
MIRT448066	hsa-miR-4476	PAR-CLIP	22100165
MIRT448064	hsa-miR-6876-5p	PAR-CLIP	22100165
MIRT448063	hsa-miR-3158-3p	PAR-CLIP	22100165
MIRT448062	hsa-miR-3921	PAR-CLIP	22100165
MIRT448061	hsa-miR-4653-5p	PAR-CLIP	22100165
MIRT448060	hsa-miR-4649-3p	PAR-CLIP	22100165
MIRT448059	hsa-miR-7162-3p	PAR-CLIP	22100165
MIRT448057	hsa-miR-3928-3p	PAR-CLIP	22100165
MIRT448058	hsa-miR-3202	PAR-CLIP	22100165
MIRT448056	hsa-miR-6822-3p	PAR-CLIP	22100165
MIRT448055	hsa-miR-760	PAR-CLIP	22100165
MIRT448054	hsa-miR-3915	PAR-CLIP	22100165
MIRT448053	hsa-miR-8057	PAR-CLIP	22100165
MIRT448066	hsa-miR-4476	PAR-CLIP	22100165
MIRT448064	hsa-miR-6876-5p	PAR-CLIP	22100165
MIRT448063	hsa-miR-3158-3p	PAR-CLIP	22100165
MIRT448062	hsa-miR-3921	PAR-CLIP	22100165
MIRT448061	hsa-miR-4653-5p	PAR-CLIP	22100165
MIRT448060	hsa-miR-4649-3p	PAR-CLIP	22100165
MIRT448059	hsa-miR-7162-3p	PAR-CLIP	22100165
MIRT448057	hsa-miR-3928-3p	PAR-CLIP	22100165
MIRT448058	hsa-miR-3202	PAR-CLIP	22100165
MIRT448056	hsa-miR-6822-3p	PAR-CLIP	22100165
MIRT448055	hsa-miR-760	PAR-CLIP	22100165
MIRT448054	hsa-miR-3915	PAR-CLIP	22100165
MIRT448053	hsa-miR-8057	PAR-CLIP	22100165
MIRT1153182	hsa-miR-1197	CLIP-seq
MIRT1153183	hsa-miR-1252	CLIP-seq
MIRT1153184	hsa-miR-148a	CLIP-seq
MIRT1153185	hsa-miR-148b	CLIP-seq
MIRT1153186	hsa-miR-152	CLIP-seq
MIRT1153187	hsa-miR-24	CLIP-seq
MIRT1153188	hsa-miR-3122	CLIP-seq
MIRT1153189	hsa-miR-3125	CLIP-seq
MIRT1153190	hsa-miR-3664-3p	CLIP-seq
MIRT1153191	hsa-miR-3913-5p	CLIP-seq
MIRT1153192	hsa-miR-3916	CLIP-seq
MIRT1153193	hsa-miR-4276	CLIP-seq
MIRT1153194	hsa-miR-4283	CLIP-seq
MIRT1153195	hsa-miR-4287	CLIP-seq
MIRT1153196	hsa-miR-4292	CLIP-seq
MIRT1153197	hsa-miR-4308	CLIP-seq
MIRT1153198	hsa-miR-4436a	CLIP-seq
MIRT1153199	hsa-miR-4437	CLIP-seq
MIRT1153200	hsa-miR-4469	CLIP-seq
MIRT1153201	hsa-miR-4489	CLIP-seq
MIRT1153202	hsa-miR-4533	CLIP-seq
MIRT1153203	hsa-miR-4685-3p	CLIP-seq
MIRT1153204	hsa-miR-4699-3p	CLIP-seq
MIRT1153205	hsa-miR-4747-5p	CLIP-seq
MIRT1153206	hsa-miR-583	CLIP-seq
MIRT1153207	hsa-miR-885-3p	CLIP-seq
MIRT1153182	hsa-miR-1197	CLIP-seq
MIRT2043855	hsa-miR-1231	CLIP-seq
MIRT1153183	hsa-miR-1252	CLIP-seq
MIRT2043856	hsa-miR-1587	CLIP-seq
MIRT1153187	hsa-miR-24	CLIP-seq
MIRT2043857	hsa-miR-2467-5p	CLIP-seq
MIRT2043858	hsa-miR-3120-5p	CLIP-seq
MIRT1153188	hsa-miR-3122	CLIP-seq
MIRT1153189	hsa-miR-3125	CLIP-seq
MIRT2043859	hsa-miR-3150a-3p	CLIP-seq
MIRT2043860	hsa-miR-3175	CLIP-seq
MIRT2043861	hsa-miR-3188	CLIP-seq
MIRT2043862	hsa-miR-339-5p	CLIP-seq
MIRT1153190	hsa-miR-3664-3p	CLIP-seq
MIRT1153191	hsa-miR-3913-5p	CLIP-seq
MIRT1153192	hsa-miR-3916	CLIP-seq
MIRT2043863	hsa-miR-3938	CLIP-seq
MIRT2043864	hsa-miR-3975	CLIP-seq
MIRT1153194	hsa-miR-4283	CLIP-seq
MIRT1153195	hsa-miR-4287	CLIP-seq
MIRT1153196	hsa-miR-4292	CLIP-seq
MIRT1153197	hsa-miR-4308	CLIP-seq
MIRT2043865	hsa-miR-4417	CLIP-seq
MIRT2043866	hsa-miR-4420	CLIP-seq
MIRT2043867	hsa-miR-4421	CLIP-seq
MIRT1153198	hsa-miR-4436a	CLIP-seq
MIRT1153199	hsa-miR-4437	CLIP-seq
MIRT2043868	hsa-miR-4468	CLIP-seq
MIRT1153200	hsa-miR-4469	CLIP-seq
MIRT2043869	hsa-miR-4488	CLIP-seq
MIRT1153201	hsa-miR-4489	CLIP-seq
MIRT2043870	hsa-miR-4492	CLIP-seq
MIRT2043871	hsa-miR-4498	CLIP-seq
MIRT1153202	hsa-miR-4533	CLIP-seq
MIRT2043872	hsa-miR-4651	CLIP-seq
MIRT2043873	hsa-miR-4656	CLIP-seq
MIRT2043874	hsa-miR-4667-5p	CLIP-seq
MIRT2043875	hsa-miR-4675	CLIP-seq
MIRT1153203	hsa-miR-4685-3p	CLIP-seq
MIRT2043876	hsa-miR-4697-5p	CLIP-seq
MIRT2043877	hsa-miR-4700-5p	CLIP-seq
MIRT2043878	hsa-miR-4731-5p	CLIP-seq
MIRT2043879	hsa-miR-4741	CLIP-seq
MIRT1153205	hsa-miR-4747-5p	CLIP-seq
MIRT2043880	hsa-miR-4787-5p	CLIP-seq
MIRT2043881	hsa-miR-485-5p	CLIP-seq
MIRT2043882	hsa-miR-516b	CLIP-seq
MIRT2043883	hsa-miR-541	CLIP-seq
MIRT1153206	hsa-miR-583	CLIP-seq
MIRT2043884	hsa-miR-608	CLIP-seq
MIRT2043885	hsa-miR-637	CLIP-seq
MIRT2043886	hsa-miR-654-5p	CLIP-seq
MIRT2043887	hsa-miR-670	CLIP-seq
MIRT2043888	hsa-miR-762	CLIP-seq
MIRT2043889	hsa-miR-939	CLIP-seq
MIRT1153183	hsa-miR-1252	CLIP-seq
MIRT1153184	hsa-miR-148a	CLIP-seq
MIRT1153185	hsa-miR-148b	CLIP-seq
MIRT1153186	hsa-miR-152	CLIP-seq
MIRT2273245	hsa-miR-3138	CLIP-seq
MIRT2273246	hsa-miR-3612	CLIP-seq
MIRT2273247	hsa-miR-3675-5p	CLIP-seq
MIRT1153193	hsa-miR-4276	CLIP-seq
MIRT1153195	hsa-miR-4287	CLIP-seq
MIRT2043865	hsa-miR-4417	CLIP-seq
MIRT2273248	hsa-miR-4462	CLIP-seq
MIRT2043869	hsa-miR-4488	CLIP-seq
MIRT1153202	hsa-miR-4533	CLIP-seq
MIRT2043872	hsa-miR-4651	CLIP-seq
MIRT1153203	hsa-miR-4685-3p	CLIP-seq
MIRT2273249	hsa-miR-4695-5p	CLIP-seq
MIRT2043876	hsa-miR-4697-5p	CLIP-seq
MIRT1153204	hsa-miR-4699-3p	CLIP-seq
MIRT1153205	hsa-miR-4747-5p	CLIP-seq
MIRT2043880	hsa-miR-4787-5p	CLIP-seq
MIRT2043883	hsa-miR-541	CLIP-seq
MIRT2043884	hsa-miR-608	CLIP-seq
MIRT2043885	hsa-miR-637	CLIP-seq
MIRT2273250	hsa-miR-650	CLIP-seq
MIRT2043886	hsa-miR-654-5p	CLIP-seq
MIRT2273251	hsa-miR-765	CLIP-seq
MIRT2043856	hsa-miR-1587	CLIP-seq
MIRT2043865	hsa-miR-4417	CLIP-seq
MIRT2043869	hsa-miR-4488	CLIP-seq
MIRT2043870	hsa-miR-4492	CLIP-seq
MIRT2043871	hsa-miR-4498	CLIP-seq
MIRT2043872	hsa-miR-4651	CLIP-seq
MIRT2043873	hsa-miR-4656	CLIP-seq
MIRT2043875	hsa-miR-4675	CLIP-seq
MIRT2043876	hsa-miR-4697-5p	CLIP-seq
MIRT2043879	hsa-miR-4741	CLIP-seq
MIRT2043880	hsa-miR-4787-5p	CLIP-seq
MIRT2043883	hsa-miR-541	CLIP-seq
MIRT2043884	hsa-miR-608	CLIP-seq
MIRT2043885	hsa-miR-637	CLIP-seq
MIRT2043886	hsa-miR-654-5p	CLIP-seq
MIRT2043888	hsa-miR-762	CLIP-seq
MIRT1153202	hsa-miR-4533	CLIP-seq

Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004222	Function	Metalloendopeptidase activity	IBA
GO:0004222	Function	Metalloendopeptidase activity	IEA
GO:0004222	Function	Metalloendopeptidase activity	TAS	7649159
GO:0005515	Function	Protein binding	IPI	15248212
GO:0005615	Component	Extracellular space	IBA
GO:0005886	Component	Plasma membrane	TAS	7649159
GO:0006508	Process	Proteolysis	IEA
GO:0006508	Process	Proteolysis	TAS	14645246
GO:0008047	Function	Enzyme activator activity	TAS	7559440
GO:0008233	Function	Peptidase activity	IEA
GO:0008237	Function	Metallopeptidase activity	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008270	Function	Zinc ion binding	TAS	7649159
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0022617	Process	Extracellular matrix disassembly	TAS
GO:0030198	Process	Extracellular matrix organization	IBA
GO:0030574	Process	Collagen catabolic process	IBA
GO:0030574	Process	Collagen catabolic process	TAS
GO:0031012	Component	Extracellular matrix	IEA
GO:0032355	Process	Response to estradiol	IEA
GO:0035987	Process	Endodermal cell differentiation	IEP	23154389
GO:0036211	Process	Protein modification process	TAS	7559440
GO:0046872	Function	Metal ion binding	IEA
GO:0070006	Function	Metalloaminopeptidase activity	TAS	14645246

MIM	HGNC	e!Ensembl
602261	7161	ENSG00000102996

P51511

Protein name

Matrix metalloproteinase-15 (MMP-15) (EC 3.4.24.-) (Membrane-type matrix metalloproteinase 2) (MT-MMP 2) (MTMMP2) (Membrane-type-2 matrix metalloproteinase) (MT2-MMP) (MT2MMP) (SMCP-2)

Protein function

Endopeptidase that degrades various components of the extracellular matrix. May activate progelatinase A.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01471	PG_binding_1	49 → 106	Putative peptidoglycan binding domain	Domain
PF00413	Peptidase_M10	138 → 304	Matrixin	Domain
PF00045	Hemopexin	374 → 417	Hemopexin	Repeat
PF00045	Hemopexin	419 → 463	Hemopexin	Repeat
PF00045	Hemopexin	466 → 512	Hemopexin	Repeat
PF00045	Hemopexin	515 → 559	Hemopexin	Repeat
PF11857	DUF3377	602 → 669	Domain of unknown function (DUF3377)	Family

Tissue specificity

TISSUE SPECIFICITY: Appeared to be synthesized preferentially in liver, placenta, testis, colon and intestine. Substantial amounts are also detected in pancreas, kidney, lung, heart and skeletal muscle.

Sequence

MGSDPSAPGRPGWTGSLLGDREEAARPRLLPLLLVLLGCLGLGVAAEDAEVHAENWLRLY
GYLPQPSRHMSTMRSAQILASALAEMQRFYGIPVTGVLDEETKEWMKRPRCGVPDQFGVR
VKANLRRRRKRYALTGRKWNNHHLTFSIQNYTEKLGWYHSMEAVRRAFRVWEQATPLVFQ
EVPYEDIRLRRQKEADIMVLFASGFHGDSSPFDGTGGFLAHAYFPGPGLGGDTHFDADEP
WTFSSTDLHGNNLFLVAVHELGHALGLEHSSNPNAIMAPFYQWKDVDNFKLPEDDLRGIQ
QLYGTPDGQPQPTQPLPTVTPRRPGRPDHRPPRPPQPPPPGGKPERPPKPGPPVQPRATE
RPDQYGPNICDGDFDTVAMLRGEMFVFKGRWFWRVRHNRVLDNYPMPIGHFWRGLPGDIS
AAYERQDGRFVFFKGDRYWLFREANLEPGYPQPLTSYGLGIPYDRIDTAIWWEPTGHTFF
FQEDRYWRFNEETQRGDPGYPKPISVWQGIPASPKGAFLSNDAAYTYFYKGTKYWKFDNE
RLRMEPGYPKSILRDFMGCQEHVEPGPRWPDVARPPFNPHGGAEPGADSAEGDVGDGDGD
FGAGVNKDGGSRVVVQMEEVARTVNVVMVLVPLLLLLCVLGLTYALVQMQRKGAPRVLLY
CKRSLQEWV

Sequence length

669

Interactions

View interactions

	KEGG		Reactome
	Parathyroid hormone synthesis, secretion and action		Collagen degradation Degradation of the extracellular matrix Activation of Matrix Metalloproteinases

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEVELOPMENTAL DISABILITIES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (51)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	14755238, 16093241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	LHGDN	17029196		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10531073	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	11824946		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	10027400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	10027400	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	31002134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	15739263, 18503039, 19243594, 19531263, 25029110	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23568046	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	22576687	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	27374080, 30809850, 9751409		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	33278774	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	27046058		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	23228395		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	31470617	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	21751260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	21751260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	22576687		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22576687, 33048115	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	25031779	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	10027400, 9708803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	10027400, 9708803	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	10027400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	16033774		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	22471305	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	22368270, 30809850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	11561728, 31191014		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	25031779	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25031779	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	27046058		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	23228395		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	21751260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16093241, 19915148, 21751260, 22576687, 26028032		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	9708803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	9708803	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	21119930	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	CTD_human_DG	18539642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	31551025		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10027400, 16033774, 20117087, 22576687, 23228395, 27184932		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	22086850, 30599080		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	22969001		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	23228395		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	21751260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	15928670	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	22086850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10531073		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	36574455	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	36941602	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	21451793, 25973093	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	20586027, 32049862	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	32887509	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

MMP15 (matrix metallopeptidase 15)