MMP9 (matrix metallopeptidase 9)

Gene

• Entrez ID: 4318
• Gene name: Matrix metallopeptidase 9
• Gene symbol: MMP9
• Synonyms (NCBI Gene): CLG4B, GELB, MANDP2, MMP-9
• Chromosome: 20
• Chromosome location: 20q13.12
• Summary: Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as art

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs41529445	C>T	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Coding sequence variant, missense variant
rs121434556	T>A,C	Conflicting-interpretations-of-pathogenicity	Missense variant, initiator codon variant
rs144098289	G>A	Conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT005743	hsa-miR-451a	qRT-PCR, Western blot	20816946
MIRT006134	hsa-miR-491-5p	Luciferase reporter assay, Microarray, Western blot	21831363
MIRT006134	hsa-miR-491-5p	Luciferase reporter assay, Microarray, Western blot	21831363
MIRT006134	hsa-miR-491-5p	Luciferase reporter assay, Microarray, Western blot	21831363
MIRT006134	hsa-miR-491-5p	Luciferase reporter assay, Microarray, Western blot	21831363
MIRT006134	hsa-miR-491-5p	Luciferase reporter assay, Microarray, Western blot	21831363
MIRT006134	hsa-miR-491-5p	Luciferase reporter assay, Microarray, Western blot	21831363
MIRT019229	hsa-miR-338-3p	Western blot;qRT-PCR	21671467
MIRT030871	hsa-miR-21-5p	qRT-PCR	19435867
MIRT006134	hsa-miR-491-5p	Immunohistochemistry, Microarray, qRT-PCR, Western blot	23725476
MIRT053482	hsa-miR-9-5p	qRT-PCR	21931274
MIRT053791	hsa-miR-211-5p	Immunoblot, Immunohistochemistry, qRT-PCR	23183822
MIRT054561	hsa-let-7e-5p	Luciferase reporter assay, qRT-PCR, Western blot	24503540
MIRT438916	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR	23354167
MIRT438251	hsa-miR-133b	Luciferase reporter assay	24714873
MIRT438251	hsa-miR-133b	Luciferase reporter assay	24714873
MIRT438916	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR	23354167
MIRT438251	hsa-miR-133b	Luciferase reporter assay	24714873
MIRT438251	hsa-miR-133b	Luciferase reporter assay	24714873
MIRT006134	hsa-miR-491-5p	Luciferase reporter assay	27023472
MIRT024984	hsa-miR-204-5p	Luciferase reporter assay, Western blot	28280358
MIRT024984	hsa-miR-204-5p	Luciferase reporter assay, Western blot	28280358
MIRT734525	hsa-miR-143-3p	qRT-PCR, Western blot	26722463
MIRT732759	hsa-miR-335-5p	Immunofluorescence, qRT-PCR	33919449
MIRT733783	hsa-miR-542-3p	ELISA, Western blotting	33785768
MIRT733783	hsa-miR-542-3p	ELISA, Western blotting	33785768
MIRT734174	hsa-miR-149-5p	Luciferase reporter assay, qRT-PCR, Western blotting	31956374
MIRT734510	hsa-miR-330-5p	Western blotting	32665904
MIRT734525	hsa-miR-143-3p	qRT-PCR	32449873
MIRT734902	hsa-miR-516a-5p	Luciferase reporter assay, Western blotting, Immunoprecipitaion (IP), Immunohistochemistry (IHC), qRT-PCR	33377649
MIRT030871	hsa-miR-21-5p	Luciferase reporter assay, Western blotting, qRT-PCR	33312752
MIRT736991	hsa-miR-194-3p	Luciferase reporter assay, Western blotting, qRT-PCR	34239873
MIRT737345	hsa-miR-140-3p	Luciferase reporter assay, Western blotting, qRT-PCR	32194906
MIRT024984	hsa-miR-204-5p	Luciferase reporter assay, qRT-PCR	37372062
MIRT006134	hsa-miR-491-5p	Luciferase reporter assay, Western blotting, qRT-PCR, ELISA	34664683
MIRT756342	hsa-miR-518a-5p	Western blotting, qRT-PCR	37132750
MIRT756430	hsa-miR-146a-5p	qRT-PCR	36415628
MIRT756467	hsa-miR-182-5p	qRT-PCR	38796528
MIRT756467	hsa-miR-182-5p	qRT-PCR	38796528
MIRT2273337	hsa-miR-133a	CLIP-seq
MIRT2273338	hsa-miR-1915	CLIP-seq
MIRT2273339	hsa-miR-296-3p	CLIP-seq
MIRT2273340	hsa-miR-4281	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CIITA	Repression	15247301
ELF3	Repression	18302674
ELF4	Repression	12438253
EP300	Activation	18985009
ETS1	Activation	22270366
ETS1	Unknown	10949659;11556732
ETS2	Activation	12438253
FOS	Activation	18809380;21238464
FOS	Repression	21474819
FOS	Unknown	10935492;11774399
HDAC1	Repression	22879913
IKBKB	Repression	18600306
IRF1	Unknown	12105194
JUN	Activation	15777790;18809380
JUN	Repression	21474819
JUN	Unknown	10935492;11774399
KLF5	Activation	18617520
KLF6	Repression	17071613;22211962
KLF8	Activation	21151179
MAL	Unknown	19724058
MAZ	Unknown	16148153
MTA1	Unknown	12431981
NFKB1	Activation	10359016;12193473;14600595;15536164;16014933;16687076;17121934;17174275;17186550;17498959;18056465;18298869;18567920;18801463;18843978;19303700;19454280;19539355;21963718
NFKB1	Repression	15605368;18566231
NFKB1	Unknown	11376631;12105194;14755547;15175338;17158602;17673602;17922642;18357389;19662350;19783786;20103608;20332461;7860222;9500201;9679762
NFKBIA	Unknown	11376631
PPARA	Repression	21840940
PPARG	Repression	20021931
RELA	Activation	10359016;12193473;14600595;15536164;16014933;16687076;17121934;17174275;17186550;17498959;18056465;18298869;18567920;18801463;18843978;19303700;19454280;19539355;21238464;21963718
RELA	Repression	15086314;15605368;18566231
RELA	Unknown	11376631;12105194;14755547;15175338;17158602;17673602;17922642;18357389;19662350;19783786;20103608;20332461;7860222;9500201;9679762
RUNX3	Repression	21128246
SIRT1	Repression	19376817;21474819
SMAD3	Repression	15086314
SNAI2	Activation	22074556
SP1	Activation	19616522;21963718
SP1	Unknown	11060311;18357389;7860222
SP2	Repression	17071613
SPDEF	Repression	20550708;22761428
SRF	Unknown	19724058
STAT1	Repression	19965686
STAT3	Repression	20067773
TFAP2A	Activation	17224907
TFAP2A	Repression	17224907

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001501	Process	Skeletal system development	IEA
GO:0001934	Process	Positive regulation of protein phosphorylation	IMP	22984561
GO:0004175	Function	Endopeptidase activity	EXP	9256427, 12062105
GO:0004175	Function	Endopeptidase activity	IDA	19022250
GO:0004222	Function	Metalloendopeptidase activity	IBA
GO:0004222	Function	Metalloendopeptidase activity	IDA	2551898, 9789069, 16192646, 24164424
GO:0004222	Function	Metalloendopeptidase activity	IEA
GO:0004222	Function	Metalloendopeptidase activity	TAS
GO:0004252	Function	Serine-type endopeptidase activity	EXP	17428795
GO:0004252	Function	Serine-type endopeptidase activity	TAS
GO:0005515	Function	Protein binding	IPI	2251898, 16512877, 21441952, 23123160, 23601700, 29328525
GO:0005518	Function	Collagen binding	TAS	2551898
GO:0005576	Component	Extracellular region	HDA	27068509
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	2551898, 25645918
GO:0006508	Process	Proteolysis	IDA	2551898, 15863497, 19022250, 24164424
GO:0006508	Process	Proteolysis	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0007566	Process	Embryo implantation	IEA
GO:0008233	Function	Peptidase activity	IDA	23845380
GO:0008233	Function	Peptidase activity	IEA
GO:0008237	Function	Metallopeptidase activity	IDA	26514923
GO:0008237	Function	Metallopeptidase activity	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008270	Function	Zinc ion binding	TAS	2551898
GO:0016477	Process	Cell migration	IGI	28280358
GO:0016477	Process	Cell migration	TAS	23675531
GO:0016787	Function	Hydrolase activity	IEA
GO:0022617	Process	Extracellular matrix disassembly	IEA
GO:0022617	Process	Extracellular matrix disassembly	TAS
GO:0030198	Process	Extracellular matrix organization	IBA
GO:0030198	Process	Extracellular matrix organization	IEA
GO:0030225	Process	Macrophage differentiation	TAS	2551898
GO:0030574	Process	Collagen catabolic process	IBA
GO:0030574	Process	Collagen catabolic process	IEA
GO:0030574	Process	Collagen catabolic process	IEA
GO:0030574	Process	Collagen catabolic process	TAS
GO:0031012	Component	Extracellular matrix	HDA	28344315
GO:0031012	Component	Extracellular matrix	IEA
GO:0035987	Process	Endodermal cell differentiation	IEA
GO:0035987	Process	Endodermal cell differentiation	IEP	23154389
GO:0042802	Function	Identical protein binding	IPI	17937912, 18077379, 23601700
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IMP	22984561
GO:0043388	Process	Positive regulation of DNA binding	IDA	22984561
GO:0045742	Process	Positive regulation of epidermal growth factor receptor signaling pathway	IMP	22984561
GO:0046872	Function	Metal ion binding	IEA
GO:0048013	Process	Ephrin receptor signaling pathway	IEA
GO:0048013	Process	Ephrin receptor signaling pathway	TAS
GO:0051239	Process	Regulation of multicellular organismal process	IEA
GO:0051549	Process	Positive regulation of keratinocyte migration	IMP	17704059
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0071222	Process	Cellular response to lipopolysaccharide	TAS	25049354
GO:0071492	Process	Cellular response to UV-A	IDA	31380578
GO:0071492	Process	Cellular response to UV-A	IEA
GO:0090200	Process	Positive regulation of release of cytochrome c from mitochondria	IMP	22984561
GO:0150077	Process	Regulation of neuroinflammatory response	TAS	25049354
GO:1904063	Process	Negative regulation of cation transmembrane transport	IDA	24164424
GO:1904645	Process	Response to amyloid-beta	IEA
GO:1904645	Process	Response to amyloid-beta	ISS
GO:1904707	Process	Positive regulation of vascular associated smooth muscle cell proliferation	IEA
GO:1904707	Process	Positive regulation of vascular associated smooth muscle cell proliferation	IMP	18667463
GO:1904724	Component	Tertiary granule lumen	TAS
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS
GO:2000697	Process	Negative regulation of epithelial cell differentiation involved in kidney development	IEA
GO:2000697	Process	Negative regulation of epithelial cell differentiation involved in kidney development	ISS
GO:2001243	Process	Negative regulation of intrinsic apoptotic signaling pathway	IMP	22984561

Other IDs

• MIM: 120361
• HGNC: 7176
• e!Ensembl: ENSG00000100985

Protein

• UniProt ID: P14780
• Protein name: Matrix metalloproteinase-9 (MMP-9) (EC 3.4.24.35) (92 kDa gelatinase) (92 kDa type IV collagenase) (Gelatinase B) (GELB) [Cleaved into: 67 kDa matrix metalloproteinase-9; 82 kDa matrix metalloproteinase-9]
• Protein function: Matrix metalloproteinase that plays an essential role in local proteolysis of the extracellular matrix and in leukocyte migration (PubMed:12879005, PubMed:1480034, PubMed:2551898). Could play a role in bone osteoclastic resorption (By similarity
• PDB: 1GKC, 1GKD, 1ITV, 1L6J, 2OVX, 2OVZ, 2OW0, 2OW1, 2OW2, 4H1Q, 4H2E, 4H3X, 4H82, 4HMA, 4JIJ, 4JQG, 4WZV, 4XCT, 5CUH, 5I12, 5TH6, 5TH9, 5UE3, 5UE4, 6ESM, 8K5V, 8K5W, 8K5X, 8K5Y
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01471	PG_binding_1	38 → 94	Putative peptidoglycan binding domain	Domain
  PF00413	Peptidase_M10	115 → 444	Matrixin	Domain
  PF00040	fn2	230 → 271	Fibronectin type II domain	Domain
  PF00040	fn2	288 → 329	Fibronectin type II domain	Domain
  PF00040	fn2	347 → 388	Fibronectin type II domain	Domain
  PF00045	Hemopexin	521 → 565	Hemopexin	Repeat
  PF00045	Hemopexin	567 → 608	Hemopexin	Repeat
  PF00045	Hemopexin	613 → 656	Hemopexin	Repeat
  PF00045	Hemopexin	661 → 704	Hemopexin	Repeat

• Tissue specificity: TISSUE SPECIFICITY: Detected in neutrophils (at protein level) (PubMed:7683678). Produced by normal alveolar macrophages and granulocytes. {ECO:0000269|PubMed:7683678}.
• Sequence:

  MSLWQPLVLVLLVLGCCFAAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEM
  RGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHN
  ITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYP
  FDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRS
  YSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYS
  ACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYST
  CTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMY
  PMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSER
  PTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYW
  RFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRR
  LDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLD
  THDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED

• Sequence length: 707

Pathways

KEGG:

Endocrine resistance
IL-17 signaling pathway
TNF signaling pathway
Leukocyte transendothelial migration
Estrogen signaling pathway
Relaxin signaling pathway
Hepatitis B
Pathways in cancer
Transcriptional misregulation in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Prostate cancer
Bladder cancer
Diabetic cardiomyopathy
Lipid and atherosclerosis
Fluid shear stress and atherosclerosis

Reactome:

Signaling by SCF-KIT
Collagen degradation
Degradation of the extracellular matrix
Activation of Matrix Metalloproteinases
Assembly of collagen fibrils and other multimeric structures
EPH-ephrin mediated repulsion of cells
Interleukin-4 and Interleukin-13 signaling
Neutrophil degranulation
Extra-nuclear estrogen signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Metaphyseal anadysplasia 2	Pathogenic; Likely pathogenic	rs1302101551, rs2515612990, rs139620474	RCV001332545 RCV003219181 RCV003219201	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANGINA, STABLE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANGLE CLOSURE GLAUCOMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AORTIC ANEURYSM	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AORTIC ANEURYSM, ABDOMINAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AORTIC ANEURYSM, THORACIC	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AORTIC DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AORTIC RUPTURE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTERIOSCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTROCYTOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATROPHIC MACULAR DEGENERATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIARY TRACT CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BONE NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN EDEMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN INJURIES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN INJURIES, TRAUMATIC	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CALCINOSIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, NON-SMALL-CELL LUNG	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, SQUAMOUS CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CAROTID ARTERY DISEASES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBRAL HEMORRHAGE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBRAL INFARCTION	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLESTASIS, EXTRAHEPATIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC LEFT-SIDED ULCERATIVE COLITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE AIRWAY DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC SKIN ULCER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLITIS, ULCERATIVE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Benign	ClinVar GWAS catalog	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
CORONARY ARTERIOSCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DESBUQUOIS SYNDROME	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEVELOPMENTAL ABSENCE OF TOOTH	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEUROPATHIES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC RETINOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DOWN SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Conflicting classifications of pathogenicity	ClinVar GWAS catalog	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
GASTRIC ULCER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GIANT CELL ARTERITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar GWAS catalog	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
HYPERPLASIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTRACRANIAL ANEURYSM	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG DISEASES, INTERSTITIAL	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUPUS NEPHRITIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MANDIBULOACRAL DYSPLASIA WITH TYPE A LIPODYSTROPHY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MARFAN SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mendelian syndromes with cleft lip/palate	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MMP9-related disorder	Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROBLASTOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-HODGKINS LYMPHOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ORAL SUBMUCOSAL FIBROSIS, INCLUDING OF TONGUE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ORAL SUBMUCOUS FIBROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OROFACIAL CLEFTING SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN ENDOMETRIOID CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIODONTITIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY DISEASE, CHRONIC OBSTRUCTIVE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY FIBROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RUPTURED ABDOMINAL AORTIC ANEURYSM	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RUPTURED AORTIC ANEURYSM	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RUPTURED THORACIC AORTIC ANEURYSM	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEPSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SICCA SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SJOGRENS SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SLEEP APNEA, OBSTRUCTIVE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE WITHDRAWAL SYNDROME	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC SCLERODERMA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THORACOABDOMINAL AORTIC ANEURYSM, RUPTURED	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VARICOSITY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENTRICULAR SEPTAL DEFECTS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
WET MACULAR DEGENERATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acoustic Neuroma	Acoustic Neuroma	BEFREE	20205165		★☆☆☆☆ Found in Text Mining only
Acute Cerebrovascular Accidents	Stroke	BEFREE	22200563, 22342361, 22395947		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	LHGDN	15952124, 17487763		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	17892998, 23377317, 23793312, 24709882, 24938016, 29349668, 29563383		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	CTD_human_DG	20981132		★☆☆☆☆ Found in Text Mining only
Acute encephalopathy	Encephalopathy	BEFREE	23034800		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	17350093, 29896797		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	10650782		★☆☆☆☆ Found in Text Mining only
Acute myelomonocytic leukemia	Myelomonocytic Leukemia	BEFREE	27039800		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	30515825, 31192912		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	9665201		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	10914717, 11585739, 16687484, 17493236, 19596921, 19680827, 21839130, 22292754, 23527119, 25562781, 26782587		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	15820246, 17493236, 18706098		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	29761931		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	22121096, 25562781		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	17240363, 20652762, 22503731, 23349885, 25542236, 26782587, 27456862, 28606921, 28677624, 28919743, 28983601, 29443542, 29896983, 30718593, 31140025		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	10914717		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	31545446, 7506923		★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	LHGDN	17029196		★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	BEFREE	30361787		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	17768685, 18347934, 19480010, 26071077, 7669564, 8068180		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	18347934		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	15536164		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyps	Adenomatous Polyposis	BEFREE	14520690, 17394006		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyps	Adenomatous Polyposis	LHGDN	17394006		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	29654109, 30140998		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	35178444	Associate	★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	Pubtator	23185624, 26377633	Stimulate	★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	17350093		★☆☆☆☆ Found in Text Mining only
Adult Hepatocellular Carcinoma	Liver carcinoma	BEFREE	25173640, 28357609		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	1402008		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	17510426, 21148633, 23728345, 28416738		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	11830485, 25189759		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	LHGDN	11830485		★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	11157561		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	15834245, 24079541, 25162123, 28765149, 30289322, 9761302		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	25797250		★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	BEFREE	17448043		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	16106101, 20860724, 21339035, 22237587, 28259919, 30446828		★☆☆☆☆ Found in Text Mining only
Alport Syndrome	Alport Syndrome	BEFREE	16509766		★☆☆☆☆ Found in Text Mining only
Alveolitis, Fibrosing	Alveolitis	CTD_human_DG	21468558		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	17697439	Stimulate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	20561382, 24731980, 25757756, 32812532, 32925069, 8987819	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	40599432	Inhibit	★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	BEFREE	20070483, 25099616, 27868311, 29964338		★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	Pubtator	23303021, 25099616, 26899292	Associate	★☆☆☆☆ Found in Text Mining only
Amyloid Neuropathies, Familial	AMYLOID CARDIOMYOPATHY	BEFREE	15536164		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	19295164, 19808299, 31192581, 31209784, 31522299, 31814469		★☆☆☆☆ Found in Text Mining only
AMYLOIDOSIS, HEREDITARY, TRANSTHYRETIN-RELATED	Amyloidosis	BEFREE	15536164		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	LHGDN	15652414		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	17362932, 19484688, 24040066, 30458231		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	24040066, 37736756	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic lateral sclerosis 1	Amyotrophic lateral sclerosis	Pubtator	24040066	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Sporadic	Lateral Sclerosis	BEFREE	19484688		★☆☆☆☆ Found in Text Mining only
Anaphylaxis	Anaphylaxis	Pubtator	30189430	Stimulate	★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	24670409		★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	CTD_human_DG	20188714		★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	BEFREE	8521611		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	23150684, 29734379, 30272291		★☆☆☆☆ Found in Text Mining only
Aneurysm	Aneurysm	Pubtator	14681642, 18971037, 25932641, 29291905	Associate	★☆☆☆☆ Found in Text Mining only
Aneurysm, Dissecting	Aortic Aneurysm	BEFREE	14963289, 30169834		★☆☆☆☆ Found in Text Mining only
Angina Stable	Angina pectoris	Pubtator	12205736	Associate	★☆☆☆☆ Found in Text Mining only
Angina Stable	Angina pectoris	Pubtator	21559401	Stimulate	★☆☆☆☆ Found in Text Mining only
Angina Unstable	Angina pectoris	Pubtator	34239024	Associate	★☆☆☆☆ Found in Text Mining only
Angina, Unstable	Intermediate coronary syndrome	BEFREE	31572549		★☆☆☆☆ Found in Text Mining only
Angioedemas Hereditary	Angioedema	Pubtator	31236065	Associate	★☆☆☆☆ Found in Text Mining only
Angiofibroma	Angiofibroma	BEFREE	17950779		★☆☆☆☆ Found in Text Mining only
Angle Closure Glaucoma	Angle Closure Glaucoma	BEFREE	17110919, 18552608, 19633731, 21655354, 23441116, 26854036, 27272641, 29432439		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Angle Closure Glaucoma	Angle Closure Glaucoma	LHGDN	17110919, 18552608		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aniridia	Aniridia	Pubtator	40570009	Associate	★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	29067128		★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	17348445	Inhibit	★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	24351915	Associate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	22234980, 25217324, 29156810, 30171263, 30941918		★☆☆☆☆ Found in Text Mining only
Anophthalmia with pulmonary hypoplasia	Anophthalmia	Pubtator	24847910	Associate	★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	BEFREE	27891714		★☆☆☆☆ Found in Text Mining only
Anovulation	Anovulation	Pubtator	40287692	Associate	★☆☆☆☆ Found in Text Mining only
Anterior subcapsular cataract	Subcapsular cataract	BEFREE	18809398		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	28353360		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	28353360, 29288745		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	CTD_human_DG	10231640		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aortic Aneurysm	Aortic aneurysm	Pubtator	11743569, 30922233	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aortic Aneurysm	Aortic Aneurysm	BEFREE	16476613, 23220275, 24080131, 27659153, 27663582, 28413030, 28683125, 28849199, 30373522, 30922233, 7627707		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aortic Aneurysm	Aortic Aneurysm	LHGDN	16476613, 16678588		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aortic Aneurysm	Aortic aneurysm	Pubtator	28849199	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	11436088, 12096274, 12928630, 14522424, 14681642, 14743151, 18763261, 19268776, 20226696, 21944916, 22571802, 22942228, 24980077, 25033895, 25854712, 26781079, 28209269, 28735510, 29291905, 34348653, 34814367	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	11854734, 11877705, 16432074, 18502079, 28446225, 29687775, 33858751	Stimulate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Thoracic	Thoracic aortic aneurysm	Pubtator	15876810, 30957625	Stimulate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Thoracic	Thoracic aortic aneurysm	Pubtator	16476613, 16678588, 25120286, 29158612, 29291905	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	10415728, 10558909, 11436088, 11854734, 12208863, 14681642, 14764734, 15254597, 15944607, 17182923, 17182940, 17223007, 17721627, 18204791, 18763261, 19652591, 20513153, 20615646, 20842516, 22365948, 22556334, 22571802, 22942228, 23813847, 23988549, 24080131, 24337353, 24801553, 25854712, 26781079, 27363580, 27533781, 28155626, 28288890, 28413030, 28420827, 28433630, 28446225, 28545777, 28839206, 29262630, 29291905, 29312500, 29545260, 29687775, 29739236, 29945457, 29956759, 29977360, 30351992, 30373522, 30535428, 31294623, 31320700, 31325435, 31680049, 7762981, 9588507, 9763536		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aortic Aneurysm, Abdominal	Aortic Aneurysm	LHGDN	16432074, 17574455, 17964292, 17964826		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aortic Aneurysm, Abdominal	Aortic Aneurysm	CTD_human_DG	17196988		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aortic Aneurysm, Ruptured	Aortic Aneurysm	CTD_human_DG	18178469		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Thoracic	Aortic Aneurysm	CTD_human_DG	16159824		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aortic Aneurysm, Thoracic	Aortic Aneurysm	BEFREE	30373522		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aortic Aneurysm, Thoracoabdominal	Aortic Aneurysm	CTD_human_DG	16159824		★☆☆☆☆ Found in Text Mining only
Aortic Diseases	Aortic Diseases	CTD_human_DG	15545515		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aortic Diseases	Aortic disease	Pubtator	23764410	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aortic Dissection	Aortic dissection	Pubtator	16678588, 9502412	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Rupture	Aortic Rupture	CTD_human_DG	18178469		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aortic Rupture	Aortic Rupture	BEFREE	28420827, 31325435		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aortic valve calcification	Aortic valve calcification	BEFREE	12963177		★☆☆☆☆ Found in Text Mining only
Aortic Valve Disease	Aortic valve disease	Pubtator	24093773	Associate	★☆☆☆☆ Found in Text Mining only
Aortic valve disorder	Aortic Valve Disease	BEFREE	24093773		★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic valve disease	Pubtator	31858570, 33029260	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic Valve Sclerosis	BEFREE	12963177		★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic valve stenosis	Pubtator	36199424	Associate	★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	25797250		★☆☆☆☆ Found in Text Mining only
Apraxia, Developmental Verbal	Apraxia	BEFREE	20872564		★☆☆☆☆ Found in Text Mining only
Arterial Occlusive Diseases	Arterial Occlusive Disease	BEFREE	11854734		★☆☆☆☆ Found in Text Mining only
Arterial Occlusive Diseases	Arterial occlusive disease	Pubtator	11854734, 16311343, 29687775	Stimulate	★☆☆☆☆ Found in Text Mining only
Arterial Occlusive Diseases	Arterial occlusive disease	Pubtator	14522424, 14612207	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	10199873, 12205736, 12728308, 15823277, 16574900, 16652230, 17261792, 18173548, 18590331, 18647135, 18810583, 19144335, 19438845, 20682172, 21733941, 22060290, 22809399, 22906271, 23819814, 24369095, 25077563, 27237101, 27696392, 28189525, 28672731, 28957799, 29104665, 29288721, 29420356, 29579712, 29960897, 30015874, 30347750, 30583923, 30926224, 31001118, 31265956, 31772631, 9653834		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arteriovenous Malformations	Arteriovenous malformations	Pubtator	27075045, 29052569	Associate	★☆☆☆☆ Found in Text Mining only
Arteriovenous Malformations, Cerebral	Cerebral arteriovenous malformation	BEFREE	31275742		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	11592363, 27052781	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	11824946, 14749977, 16148153, 26481104, 29475408, 29706965, 30267195, 30397034, 30831463, 31152077		★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	34480465	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	11592363, 34305455, 34691360	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	12735638, 22829602	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10531073, 10817568, 16507143, 18567920, 24309559, 26350950, 27498552, 30242542, 31430907, 32508836, 33148884, 35653890, 40238799	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	15457463, 17763449, 34290266	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis, Gouty	Gouty arthritis	LHGDN	14687896		★☆☆☆☆ Found in Text Mining only
Arthropathy	Arthropathy	BEFREE	15212936		★☆☆☆☆ Found in Text Mining only
Asbestosis	Asbestosis	BEFREE	29149883		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	11167375, 12495928, 14657859, 14734780, 16026590, 16061701, 16275889, 16631427, 17403951, 19667087, 20181264, 21644819, 22052126, 22237587, 22461694, 23244755, 23639553, 25650123, 26123447, 27395373, 27780376, 28358425, 28507585, 29600353, 30181695, 30931075, 31332973, 31547356, 31653934, 31781316		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	11353845, 12735676, 12947131, 14734780, 17579045, 20181264, 23804543, 24993912, 27378824, 27395373, 28051223, 30217493, 32820688, 36575422, 38128411	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	CTD_human_DG	11742282, 15131573		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	LHGDN	12789238, 12861851, 16631427, 16754484		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	18321931, 21170080, 28933920, 31653934	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma, Aspirin-Induced	Asthma	BEFREE	19958602		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	10895974, 16206166, 17502998, 17880928, 18834856, 19287189, 19775294, 20188714, 22465218, 30286327		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	LHGDN	18563800		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	Pubtator	19775294, 27043542, 28901379	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	CTD_human_DG	20188714		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asymmetric crying face association	Asymmetric crying face association	BEFREE	31353051		★☆☆☆☆ Found in Text Mining only
Asymmetric Diabetic Proximal Motor Neuropathy	Asymmetric Diabetic Proximal Motor Neuropathy	CTD_human_DG	20213226		★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	23681803, 30581847		★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	35782055	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	10199873, 12205736, 12728308, 15823277, 16574900, 16652230, 17261792, 18173548, 18590331, 18647135, 18810583, 19144335, 19438845, 20682172, 21733941, 22060290, 22809399, 22906271, 23819814, 24369095, 25077563, 27237101, 27696392, 28189525, 28672731, 28957799, 29104665, 29288721, 29420356, 29579712, 29960897, 30015874, 30347750, 30583923, 30926224, 31265956, 31772631, 9653834		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	11805151, 15056843, 16311343, 18541003, 18647135, 18945772, 21733941, 22879913, 23819814, 24025248, 25153995, 26377769, 27237101, 28500763, 30257242, 31878149, 34122426, 35059464, 35842645, 37547382, 37880698, 37978381, 38181273, 9665460	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	15823277, 15896974, 16159601		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	17198804, 22906271	Stimulate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	14998623, 21659381	Stimulate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	19665460, 20458440, 20631454, 22001292, 27070579, 29324263, 29393403, 30632430, 31012282		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	20631454, 22001292, 29235504, 31012282	Associate	★☆☆☆☆ Found in Text Mining only
Atypical Endometrial Hyperplasia	Endometrial Hyperplasia	BEFREE	30139240		★☆☆☆☆ Found in Text Mining only
AURAL ATRESIA, CONGENITAL	Aural Atresia, Congenital	BEFREE	26248866		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	27957319	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	28025035, 29040407		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	BEFREE	30123106		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	37508583	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	12965253, 15841177, 16652230, 21436623, 27637385, 28577863, 29879882, 30397034		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	15642145, 18790699	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	LHGDN	16652230		★☆☆☆☆ Found in Text Mining only
Autoimmune thyroiditis	Autoimmune Thyroiditis	BEFREE	31656199		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	22049175, 25648114, 25738807, 27458102, 28356967, 28586031, 28731139, 28901509, 29207094, 30015835, 30132572, 30628640, 30779087, 31181779, 31189740, 31717324, 31760170		★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	16840734, 18326820, 19965686		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	17278189	Associate	★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	29349515		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	33941087	Stimulate	★☆☆☆☆ Found in Text Mining only
Basal Cell Nevus Syndrome	Basal cell nevus syndrome	Pubtator	35740900	Associate	★☆☆☆☆ Found in Text Mining only
Becker Muscular Dystrophy	Becker Muscular Dystrophy	BEFREE	26091074		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	20363273, 20842516, 22428754, 25639450, 28388268, 29687026		★☆☆☆☆ Found in Text Mining only
Benign Meningioma	Benign Meningioma	BEFREE	23372434		★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	10995877, 23372434		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	26564800, 27931798, 28237042, 28506859, 7506923		★☆☆☆☆ Found in Text Mining only
Bicuspid aortic valve	Bicuspid aortic valve	BEFREE	19398671, 23248206, 29176317		★☆☆☆☆ Found in Text Mining only
Bicuspid Aortic Valve Disease	Bicuspid aortic valve	Pubtator	19398671, 27634926	Associate	★☆☆☆☆ Found in Text Mining only
Bicuspid Aortic Valve Disease	Bicuspid aortic valve	Pubtator	35439345	Stimulate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	19536654, 21437990, 24402212		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	19536654, 24402212		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	BEFREE	10996723, 11299737, 11555602, 17473191, 20068172, 20574775, 20864363, 21351095, 22695075, 22895549, 23819551, 24390660, 24448324, 26069102, 26197083, 27602581, 27631965, 28040581, 28176369, 28356943, 28980922, 29209142, 29237912, 29578150, 30249503, 30526300, 31506605, 31705065, 8014015		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	16596205, 18357389		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	CTD_human_DG	30548095		★☆☆☆☆ Found in Text Mining only
Blast Crisis	Blast crisis	Pubtator	27039800	Associate	★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	24825862, 27039800		★☆☆☆☆ Found in Text Mining only
Blister	Blister	Pubtator	11710917, 31440247	Associate	★☆☆☆☆ Found in Text Mining only
Blister	Blister	Pubtator	22991566	Stimulate	★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood Coagulation Disorders	BEFREE	27841846		★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	40629026	Associate	★☆☆☆☆ Found in Text Mining only
Bloom Syndrome	Bloom syndrome	Pubtator	40016774	Stimulate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	15107580, 17854305, 31369791		★☆☆☆☆ Found in Text Mining only
Bone neoplasms	Bone neoplasms	BEFREE	15256057, 18337451		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bone neoplasms	Bone neoplasms	CTD_human_DG	16475674		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bone Resorption	Bone resorption	Pubtator	10620070, 16280328, 35363329, 38139307	Associate	★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	23028511, 24223711, 25400818	Associate	★☆☆☆☆ Found in Text Mining only
Brain Edema	Brain edema	Pubtator	22420586, 25858502, 30986397	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Edema	Brain edema	Pubtator	25821815	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Infarction	Brain infarction	Pubtator	22395947	Associate	★☆☆☆☆ Found in Text Mining only
Brain Infarction	Brain Infarction	BEFREE	29294343, 30503801		★☆☆☆☆ Found in Text Mining only
Brain Injuries	Brain injuries	Pubtator	24616914	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Injuries Traumatic	Brain injuries	Pubtator	19834375	Stimulate	★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	24067772, 25858502, 28222567, 28966304	Associate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	LHGDN	15022328, 18948614		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Ischemia	Cerebral Ischemia	CTD_human_DG	15060315		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Ischemia	Brain ischemia	Pubtator	19477169, 21424029, 23555845	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Ischemia	Brain ischemia	Pubtator	23582094	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Ischemia	Cerebral Ischemia	BEFREE	28396188, 29294343, 29849881, 31722253		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Neoplasms	Brain Neoplasms	BEFREE	14978741, 18435488, 20463757, 26663949, 28112361		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	LHGDN	16102725		★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	BEFREE	28349828		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11288958, 11781819, 12000221, 12825860, 15075244, 15538048, 15609121, 16158251, 16243823, 16267613, 16836568, 17651959, 17657740, 17683926, 17828308, 18172859, 18243246, 18451168, 18483307, 18519796, 18644862, 18821062, 19035293, 19144199, 19889214, 20617371, 20725776, 20821046, 20876703, 21106094, 21151179, 21170718, 21187089, 21503589, 21666711, 21963718, 22480333, 22542663, 22627808, 22640735, 22853317, 22878890, 22995648, 23151889, 23242121, 23292685, 23353996, 23407024, 23509357, 23550278, 23570558, 23618129, 23696797, 23750285, 24099425, 24130769, 24152909, 24211352, 24272202, 24337540, 24357512, 24596383, 24604087, 24811362, 24845596, 24859472, 25075039, 25151367, 25213553, 25605249, 25608710, 25659578, 25670016, 25735351, 25811800, 25890491, 26134759, 26608367, 26717978, 26906973, 26976638, 27087131, 27110764, 27697091, 27770930, 27779707, 27810593, 27812894, 27876502, 28212583, 28272917, 28443467, 28730767, 28754674, 28861172, 28910973, 28927117, 28961241, 28970848, 28981380, 28986926, 29107105, 29113219, 29162512, 29658601, 29684479, 30010105, 30074136, 30141614, 30142200, 30185799, 30194384, 30274515, 30320388, 30500835, 30558648, 30594607, 30993496, 31104011, 31264317, 31265880, 31306109, 31346317, 31409371, 31416219, 31444237, 31528229, 31683960, 31706051, 31814478, 31820313, 31825614, 31839881, 8570199, 9887098		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	19617202		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Diseases	Breast Diseases	BEFREE	19889214		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	11288958, 11384099, 12698185, 12874388, 15054465, 15566434, 16796815, 16984917, 17725804, 17972522, 18480415, 18503039, 19035293, 19052522, 19129556, 19243594, 19531263, 19661326, 19693769, 19796390, 19843640, 19887890, 19889214, 20650008, 20718733, 20725776, 20821288, 21047774, 21106094, 21136273, 21151179, 21167057, 21187089, 21344163, 21503589, 21666711, 21738726, 21963718, 22524830, 22627808, 22842186, 22853317, 22994744, 22994786, 22995648, 23536962, 23569720, 23618129, 23634849, 23648477, 23696797, 23902685, 24152909, 24344010, 24357512, 24377619, 24568471, 24606426, 24658161, 24845596, 24885456, 24993803, 25029110, 25081696, 25083991, 25174454, 25377085, 25670016, 25735351, 26206582, 26356670, 26501276, 26608367, 26618552, 26656588, 26717978, 26906973, 26976638, 27025601, 27042827, 27110764, 27188536, 27277077, 27456360, 27588391, 27697091, 28045923, 28198505, 28212583, 28349828, 28422741, 28730767, 28961241, 29241196, 29901696, 30010105, 30018340, 30142200, 30194384, 30320388, 30518369, 30558648, 30848576, 31167402, 31171715, 31306109, 31322183, 31331331, 31409371, 31416219, 31568637, 31683960, 31935914, 31963833, 31964465, 32037484, 32155880, 32445177, 32708426, 33099918, 33146350, 33760219, 34221232, 34246802, 34360714, 34638797, 34654351, 34775491, 34884588, 35345375, 35346972, 35697931, 35819135, 35840633, 35852149, 36293492, 36431925, 36500603, 37268731, 37556419, 37798646, 37977037, 39219290, 39351229, 39671698, 8766524	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	15739263, 23568046, 23750285, 23762835, 25151367, 25317801, 32582965	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchiectasis	Bronchiectasis	BEFREE	12762339, 19188843		★☆☆☆☆ Found in Text Mining only
Bronchiolitis Obliterans	Bronchiolitis Obliterans	LHGDN	15888067		★☆☆☆☆ Found in Text Mining only
Bronchitis Chronic	Bronchitis	Pubtator	31462114	Stimulate	★☆☆☆☆ Found in Text Mining only
Bronchitis, Chronic	Gastric Cancer	BEFREE	31462114		★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	LHGDN	12376362, 14973177		★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	19097983		★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary dysplasia	Pubtator	28103583, 39807735, 40244055	Associate	★☆☆☆☆ Found in Text Mining only
Bulimia Nervosa	Bulimia	BEFREE	27891714		★☆☆☆☆ Found in Text Mining only
Bullous pemphigoid	Bullous Pemphigoid	BEFREE	15841177, 27637385, 30218612, 31440247, 31507596, 9687525		★☆☆☆☆ Found in Text Mining only
Bursitis	Bursitis	BEFREE	15726092		★☆☆☆☆ Found in Text Mining only
Cancer of Nasopharynx	Nasopharyngeal Cancer	BEFREE	17385073, 24218340, 24576804		★☆☆☆☆ Found in Text Mining only
Cancer Pain	Cancer	Pubtator	27025601, 27277077	Associate	★☆☆☆☆ Found in Text Mining only
Cap Myopathy	Cap myopathy	Pubtator	16619495	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	14569466, 17278189, 18347934, 19141401, 20187983, 20440771, 20725776, 22009750, 22139647, 25518925, 26581505, 26916071, 27363017, 28293015, 29693178, 30070315, 30484490, 30848576, 31432165, 31831717, 33278774, 35782055	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10895017, 11371737, 11426939, 11935310, 15538048, 15929172, 17310847, 18000467, 18951930, 18980971, 19480010, 19507255, 26232338, 28927056, 8068180		★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	17591960, 22200897, 33278774	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	18843292, 24518705, 27406386, 32354918	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	16807982, 20835647	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	11384099, 16807982, 23083134	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	16273602, 16474379, 16775432, 18932288, 19239691, 19645016, 19948069, 20331628, 20440771, 21738655, 21961047, 22289527, 22363545, 22427881, 22543708, 22546345, 23035214, 23179396, 23468978, 23569130, 24065232, 24078466, 24587407, 24614035, 25110435, 25173640, 25236186, 25299117, 25472720, 25522777, 25851347, 26057631, 26165487, 26194347, 26204832, 26375669, 26404322, 26551737, 26646705, 26730736, 26847170, 27092498, 27853186, 28492136, 28508927, 31044528, 31281549, 31481647, 31499614, 31599408, 31599412, 31646557, 31696500, 31773692, 31874999, 33215860, 33378016, 33656546, 33989451, 34854209, 35127170, 35260047, 35293286, 35452485, 35840921, 36010685, 36189226, 37313905, 38179744, 38251896, 40127075	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	19465902, 31086224, 36116407, 40650282	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	16807982, 19887890, 20835647, 28178722, 28330493	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Mucoepidermoid	Mucoepidermoid carcinoma	Pubtator	37175975	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	10996723, 11299737, 11555602, 17473191, 20068172, 20574775, 20864363, 21351095, 22695075, 22895549, 23819551, 24390660, 24448324, 26069102, 26197083, 27602581, 27631965, 28040581, 28176369, 28356943, 28980922, 29209142, 29237912, 29578150, 30249503, 30526300, 30548095, 31506605, 31705065, 8014015		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	19093256, 29581776, 30061937, 31143300		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	11781819, 11935310, 14981939, 15623631, 15824527, 16061858, 16170032, 16488391, 17916907, 19596921, 19619798, 19814619, 20360147, 20392988, 21601305, 21717058, 22158108, 22455335, 22503731, 23313298, 23475608, 23681803, 23801886, 23857284, 24099107, 24366569, 24621612, 25266803, 25270791, 25703655, 25746000, 26151179, 26198673, 26323669, 26739332, 27127879, 27268917, 27545207, 28202627, 28272723, 28610954, 28677797, 29113175, 29387220, 29443542, 29928404, 30214563, 30378152, 30388099, 30431227, 30867776, 30889876, 31275410		★☆☆☆☆ Found in Text Mining only
Carcinoma of Male Breast	Breast Carcinoma, male	BEFREE	24378964		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	16124061, 16551853, 28859117, 32718331, 33763485	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	20028387	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	17378244, 18630474, 22159401, 25217324, 26219899, 27429508, 31731384, 32809114, 33730072, 36881486, 37834100	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	18706098	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	10454537, 11159211, 12410931, 15863510, 21799470, 21808237, 23006512, 23281640, 24802708, 24870795, 24986570, 25588050, 27806310, 29559845, 30338828, 30816490, 31599407, 31789394, 32413671, 32986937, 33059651, 34934046, 35178444, 37117633, 37905646	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	10935492, 12218298, 12669237, 16867869, 19064570, 19619798, 20109015, 21612954, 23572151, 25400809, 26050228, 26515234, 26916071, 31053522, 36151071, 7961122	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	19064570	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	21819702	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Transitional cell carcinoma	Pubtator	27577949	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	1402008, 19064570, 27406386		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	10831344, 15623631, 17475671, 18559505, 22471482, 22579115, 22832979, 23580092, 25738807, 26168135, 28859117, 29113212, 29461589, 30952722, 9743290		★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	BEFREE	21808237		★☆☆☆☆ Found in Text Mining only
Cardioembolic stroke	Cardioembolic Stroke	BEFREE	31074588, 31555200		★☆☆☆☆ Found in Text Mining only
Cardiomegaly	Cardiomegaly	Pubtator	31681945	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	25294955, 38025678, 39294340	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	28821969		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	10937947, 16202218, 25888309, 27890770, 31263835	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	21890325, 22395516	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Restrictive	Restrictive cardiomyopathy	Pubtator	27982503	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	LHGDN	18028894		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	31263835		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	17849172, 18028894, 24236052, 24596383, 27890770, 31263835		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	12668489, 20184534, 21266537, 21844877, 21887284, 24186934, 24291031, 25055059, 26637202, 28205286, 28523165, 29693002, 29891747, 30542429, 30557881, 30992065		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	LHGDN	17289174		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	21887284, 28205286, 30992065, 31935243, 32806763, 34639156	Associate	★☆☆☆☆ Found in Text Mining only
Carnevale syndrome	Carnevale syndrome	Pubtator	27023472	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	16774841	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carotid Artery Diseases	Carotid artery disease	LHGDN	17161406, 18173548		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carotid Artery Thrombosis	Carotid artery thrombosis	Pubtator	40724896	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	16574900, 18173548, 22906271, 24369095		★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	16774841, 18295103, 25441669, 26254334, 27017522	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	LHGDN	17030690, 18166633		★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	28500763	Stimulate	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	BEFREE	28672747, 29325936, 29875068		★☆☆☆☆ Found in Text Mining only
Carpal Tunnel Syndrome	Carpal Tunnel Syndrome	BEFREE	25572313		★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	24067484	Stimulate	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	15834245, 28586796, 30591791, 31582653, 31843793		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	22259225, 31582653	Associate	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	38212520	Stimulate	★☆☆☆☆ Found in Text Mining only
CATARACT, ANTERIOR POLAR	Cataract	BEFREE	22107133, 23792071		★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Central nervous system disease	Pubtator	11673527, 30986397	Associate	★☆☆☆☆ Found in Text Mining only
Central visual impairment	Central Visual Impairment	BEFREE	31738197		★☆☆☆☆ Found in Text Mining only
Centriacinar Emphysema	Pulmonary Emphysema	BEFREE	23734748		★☆☆☆☆ Found in Text Mining only
Centriacinar Emphysema	Pulmonary Emphysema	CTD_human_DG	25106431		★☆☆☆☆ Found in Text Mining only
Cerebellar Ataxia, Mental Retardation, And Dysequilibrium Syndrome 1	Cerebellar Ataxia, Mental Retardation, And Dysequilibrium Syndrome	BEFREE	22520332, 27914947		★☆☆☆☆ Found in Text Mining only
Cerebral Amyloid Angiopathy	Cerebral amyloid angiopathy	Pubtator	21707819, 32631441	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Amyloid Angiopathy	Cerebral amyloid angiopathy	BEFREE	26248866		★☆☆☆☆ Found in Text Mining only
Cerebral Aneurysm	Cerebral Aneurysm	BEFREE	17714769		★☆☆☆☆ Found in Text Mining only
Cerebral Astrocytoma	Astrocytoma	CTD_human_DG	20188714		★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	20420814	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	25932641, 29052569, 32631441	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Infarction	Cerebral Infarction	BEFREE	12960961, 14605329, 14617754, 17272778, 18352832, 18830828, 19477169, 19589242, 23257658, 23555845, 28059805, 28460607, 29576054, 29687870, 29849881, 30275761, 30542482, 30657570, 30872008, 31261992, 31418133		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Infarction	Ischemic stroke	Pubtator	16774841, 18342317, 19933990, 26617904, 29235504, 30257242, 30657570, 30992065, 31012282, 31074588, 33778069, 34984852, 36424752, 37547382, 38637126, 40629591, 40696650	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Infarction	Ischemic stroke	Pubtator	36066144	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Vasospasm	Cerebral Vasospasm	BEFREE	23555845		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	12975253, 14605329, 18342317, 20222942, 21232745, 22151540, 22200563, 22496335, 22591946, 22728010, 23780386, 24369095, 25012915, 25932641, 26330106, 28063771, 28130211, 28153846, 28245103, 28396199, 28460607, 28535201, 28710023, 28779350, 28963051, 29074065, 29141241, 29294343, 29763368, 29896433, 29909038, 30132967, 30158363, 30287248, 31012282, 31200003, 31349015, 31564697, 31807255		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	20827608, 21232745		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	22574960, 35620813	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	12189553, 15343380, 19996286, 24804816, 26526578, 26873866, 28599453, 29767419, 30655899, 31572058		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	21199798		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	12189553, 15343380, 17167534, 19996286, 23679328, 24804816, 26526578, 26873866, 28599453, 29151916, 29767419, 30655899, 31572058		★☆☆☆☆ Found in Text Mining only
Chagas Cardiomyopathy	Chagas Cardiomyopathy	BEFREE	28543409		★☆☆☆☆ Found in Text Mining only
Chagas Cardiomyopathy	Chagas cardiomyopathy	Pubtator	35372112	Associate	★☆☆☆☆ Found in Text Mining only
Chagas Disease	Chagas disease	Pubtator	23856618, 28118356	Associate	★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	17350093		★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	20181264, 22052126, 22237587, 30217493		★☆☆☆☆ Found in Text Mining only
Childhood Ataxia with Central Nervous System Hypomyelinization	Leukoencephalopathy with vanishing white matter	BEFREE	29349515		★☆☆☆☆ Found in Text Mining only
Childhood Cerebral Astrocytoma	Astrocytoma	CTD_human_DG	20188714		★☆☆☆☆ Found in Text Mining only
Childhood Hepatocellular Carcinoma	Liver carcinoma	BEFREE	25173640, 28357609		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	17510426, 21148633, 23728345, 28416738		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	16818654, 18710428, 19218340, 19721413, 27919591		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	LHGDN	19218340		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	19218340, 19721413, 23132676, 23480758, 23480772, 26014518, 28482619, 32020235, 33507702, 35792239	Associate	★☆☆☆☆ Found in Text Mining only
Cholecystolithiasis	Cholecystolithiasis	BEFREE	22621753		★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	BEFREE	22621753		★☆☆☆☆ Found in Text Mining only
Cholestasis of pregnancy	Cholestasis of pregnancy	BEFREE	28233754, 28477356, 31113607		★☆☆☆☆ Found in Text Mining only
Cholestasis, Extrahepatic	Cholestasis	CTD_human_DG	28789951		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholesteatoma	Cholesteatoma	Pubtator	23285167	Stimulate	★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	BEFREE	30021014, 31132150		★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	Pubtator	30021014, 36837507	Associate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	15736455, 18641983, 23661254, 24085323, 29316907	Associate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	19475568, 19896699, 29316907, 30237403		★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	18641983, 34127734	Associate	★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	22858163, 23972287		★☆☆☆☆ Found in Text Mining only
Choroidal Neovascularization	Choroidal neovascularization	Pubtator	17475706, 29346644	Associate	★☆☆☆☆ Found in Text Mining only
Chromosome 11p11.2 Deletion Syndrome	11p11.2 Deletion Syndrome	BEFREE	31440939		★☆☆☆☆ Found in Text Mining only
Chronic colitis	Colitis	BEFREE	28561062		★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	29267209, 31653934	Associate	★☆☆☆☆ Found in Text Mining only
Chronic heart failure	Heart Failure	BEFREE	28772055		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	12830465, 23010359, 29891747, 30035656, 30557881, 31722350		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	23128247, 26733721, 28526320, 30509751, 30557881, 31054069		★☆☆☆☆ Found in Text Mining only
Chronic lung disease	Lung Diseases	BEFREE	20335295		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	15483673, 16840734, 18326820, 19965686, 20159608, 21048031, 22580984, 24956101, 27637890, 28419476, 28978315, 30760844, 31585732		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	LHGDN	16840734, 17890452		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	12383023, 12495928, 14624669, 15498369, 16126934, 17403951, 19376817, 19507017, 20160424, 20970515, 21644819, 22374923, 23555986, 23606791, 24039251, 24085258, 24111605, 25332229, 26123447, 26291981, 26303146, 26439471, 26663885, 27173221, 27270564, 28004483, 28537664, 28831024, 29053025, 29222599, 29268377, 29358724, 29403273, 29765212, 30066869, 30429371, 30542429, 30643813, 30781876, 30957625, 31019060		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	LHGDN	12861851, 14676438, 16126934, 16395864, 18006877, 18619044		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	CTD_human_DG	19299917		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic otitis media	Otitis media	BEFREE	31132150		★☆☆☆☆ Found in Text Mining only
Chronic Pain	Chronic pain	Pubtator	20857147	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	15691353, 16945027, 17076610, 18155181, 21094936, 21481333, 22819245, 23252412, 29298087		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	LHGDN	16945027, 18980523		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	26743292	Stimulate	★☆☆☆☆ Found in Text Mining only
Chronic Q Fever	Q Fever	BEFREE	28179203		★☆☆☆☆ Found in Text Mining only
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	28490401, 30283454		★☆☆☆☆ Found in Text Mining only
Chronic sinusitis	Sinusitis	BEFREE	20529372, 23257253, 23987197, 30283454		★☆☆☆☆ Found in Text Mining only
Chronic venous insufficiency	Venous Insufficiency	BEFREE	28662285		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	19465902, 28607529		★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	31053527		★☆☆☆☆ Found in Text Mining only
Cleft Lip	Cleft lip	Pubtator	27876897	Associate	★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	35363329	Stimulate	★☆☆☆☆ Found in Text Mining only
Clubfoot	Clubfoot	Pubtator	35292718	Associate	★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	29475408, 29496490, 29796990, 30123106		★☆☆☆☆ Found in Text Mining only
Coffin-Siris syndrome	Coffin-Siris Syndrome	BEFREE	25004843		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	29306898, 32431079, 32812532, 36424752, 36961195, 37547382	Associate	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	31555105		★☆☆☆☆ Found in Text Mining only
Cohen syndrome	Cohen Syndrome	BEFREE	15659795		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	16344067, 17072979, 20068187, 21723221, 24465207, 25593461, 27861153, 28079248, 28561062, 29212256, 29354126, 30074183, 30471427		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	Pubtator	30227886	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Collagenous	Collagenous colitis	Pubtator	21678108, 31131860	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	21477272, 21678108, 27218676, 32871953, 37960728	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	34183667	Stimulate	★☆☆☆☆ Found in Text Mining only
Colitis, Collagenous	Colitis	BEFREE	21305678, 21678108		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	15588763, 16551873, 17224907, 17332939, 18674879, 20068187, 20609636, 21866366, 23104504, 23645734, 24085798, 24222121, 24224610, 25326065, 25902005, 26608367, 26648422, 28970726, 29237264, 30129419, 30185549, 30306455, 30349300, 30525244, 30588252, 30734664, 30877036, 8543396		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	10402168, 16687484, 32521887, 32813775	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic Neoplasms	CTD_human_DG	15725655		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic Neoplasms	BEFREE	16551873		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic Neoplasms	LHGDN	17151782, 17186550, 17224907		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Carcinoma	Colorectal Cancer	BEFREE	14520690, 15328199, 15588763, 16551873, 17059590, 17186550, 17332939, 17394006, 17729419, 18347934, 18506186, 20662554, 20683000, 21261731, 21717058, 21839130, 22472880, 22729913, 22806308, 23202950, 24240588, 24282031, 24705862, 25205654, 25961845, 25962429, 26159723, 26596835, 26601990, 26847533, 27051027, 27145365, 27222068, 27222481, 27633042, 28004430, 28293015, 28316326, 28454367, 29459827, 29520667, 29575908, 29687772, 29725465, 29763380, 30059042, 30129419, 30154846, 30228782, 30472235, 30581847, 30685432, 31010374, 31173256, 31293204, 31452782, 31540827, 31810917, 7669564, 8895669, 8955659		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	10621835, 12177807, 15991286, 16619576, 17059590, 17348445, 17729419, 18347934, 18416455, 18506186, 20443834, 21229878, 21859479, 22472880, 22739763, 23737956, 23799978, 23973996, 24240588, 24314144, 24476461, 24504172, 24564183, 24705862, 24737953, 25750173, 26497206, 26608367, 26617761, 26662150, 26714817, 27034162, 27051027, 27098148, 27110571, 28293015, 28316326, 28653875, 28787469, 28970726, 30135139, 30228782, 30365116, 30773944, 31173256, 31293204, 31434836, 32167616, 32277631, 32277632, 32408577, 32633353, 32641980, 33090398, 33573134, 33819484, 34293235, 34512817, 34830271, 35468741, 35639036, 35645356, 35647190, 35810100, 36242053, 36882818, 37313408, 37347740, 37516013, 37933160, 38376276, 38376281, 40127075, 7669564, 8883399, 9045899, 9703281	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	12097300, 15860507, 16551873, 20191032, 21839130		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	12949792, 14520690, 15328199, 15628723, 16133529, 16615041, 17394006, 17669467, 17729419, 18214299, 18214300, 18425389, 18480385, 18506186		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25472811, 28981980	Stimulate	★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	28122987, 30344689		★☆☆☆☆ Found in Text Mining only
Compression of spinal cord	Spinal cord compression	BEFREE	31054885		★☆☆☆☆ Found in Text Mining only
Congenital arteriovenous malformation	Congenital Arteriovenous Malformation	BEFREE	22796276, 24771337		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	30943495		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	21076843, 31611937		★☆☆☆☆ Found in Text Mining only
Congenital Dysplasia Of The Hip	Developmental dysplasia of the hip	BEFREE	30720210		★☆☆☆☆ Found in Text Mining only
Congenital neurologic anomalies	Drachtman Weinblatt Sitarz syndrome	BEFREE	26564090		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	16406300, 16574429, 25064116, 26112171, 28399617, 28523165, 28772055, 29663512, 29904410, 30353496, 30965053, 31053170, 31099017, 31782085		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	16466849, 16596214, 17541305, 18189328, 23969530, 24023875, 24714873, 24870795, 25588050, 26732239, 28107702, 29103203, 29190630, 30008898, 30013825, 30224058, 30249503, 30338828, 31053527, 31258725		★☆☆☆☆ Found in Text Mining only
Corneal Diseases	Corneal disease	Pubtator	19936308	Associate	★☆☆☆☆ Found in Text Mining only
Corneal dystrophy epithelial basement membrane	Corneal dystrophy	Pubtator	19710953	Associate	★☆☆☆☆ Found in Text Mining only
Corneal Injuries	Corneal injury	Pubtator	19900203, 32016117	Associate	★☆☆☆☆ Found in Text Mining only
Corneal Neovascularization	Corneal Neovascularization	BEFREE	28584076, 28644870, 31002472, 31003493		★☆☆☆☆ Found in Text Mining only
Corneal Ulcer	Corneal Ulcer	LHGDN	12967855		★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Coronary Aneurysm	BEFREE	12103254		★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Coronary Aneurysm	LHGDN	12626459		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	10199873, 11916008, 12205736, 12668489, 12728308, 15772219, 16179285, 18035073, 19283512, 19435423, 19438845, 19576641, 20184534, 20872564, 21559835, 21963461, 22664146, 22809399, 23328249, 23819814, 24040261, 24506511, 24599689, 25191702, 27323016, 27910999, 28390432, 28400830, 28739397, 29507703, 30443948, 30542429, 30726210		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	BEFREE	11916008, 12668489, 12728308, 15191941, 16179285, 17320799, 17892998, 18035073, 19283512, 19435423, 19438845, 19576641, 20184534, 21559835, 21963461, 22226810, 22664146, 22689717, 22809399, 23328249, 23377317, 23819814, 24040261, 24506511, 24599689, 24875414, 24938016, 25191702, 25687463, 27323016, 27910999, 28390432, 28400830, 28739397, 28778748, 29507703, 29763368, 30443948, 30542429, 30571600, 30726210, 31808123		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	LHGDN	11916008, 12728308, 17320799, 18067861		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	12381651, 31929842, 39684689	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	15772219, 16195613, 20534943, 20872564, 21559401, 22738689, 23819814, 24040261, 25191702, 26884859, 27323016, 28453874, 29763368, 34320932, 37453108, 38357816	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Disease	Coronary artery disease	Pubtator	22388798, 28390432	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	11916008, 12668489, 12728308, 16179285, 18035073, 19283512, 19355890, 19435423, 19438845, 19576641, 20184534, 21559835, 21887284, 21963461, 22226810, 22664146, 23328249, 23819814, 24040261, 24506511, 24599689, 25191702, 27323016, 27910999, 28390432, 28400830, 28739397, 29507703, 30443948, 30542429, 30726210, 30934954		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	LHGDN	17364896, 18035073		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Restenosis	Coronary restenosis	Pubtator	20129576	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Stenosis	Coronary Stenosis	BEFREE	20872564		★☆☆☆☆ Found in Text Mining only
Coronary Stenosis	Coronary stenosis	Pubtator	20872564	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Thrombosis	Coronary Thrombosis	BEFREE	15823277		★☆☆☆☆ Found in Text Mining only
Cough	Cough	Pubtator	25849664, 39465738	Associate	★☆☆☆☆ Found in Text Mining only
Craniocerebral Trauma	Craniocerebral trauma	Pubtator	26120586	Associate	★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Craniopharyngioma	Pubtator	24934367, 25990246	Associate	★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	23401274, 23987197, 26047816, 26709128, 28260873, 29767533, 31653934		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	17243139, 18634035, 28481042, 28723856, 29846530, 31636712		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	21535409, 31633754	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	34183667	Stimulate	★☆☆☆☆ Found in Text Mining only
Cutaneous Mastocytosis	Cutaneous mastocytosis	BEFREE	28801055		★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	17346338, 28075446		★☆☆☆☆ Found in Text Mining only
Cutis Laxa	Cutis Laxa	BEFREE	11139471, 19010778, 9666818		★☆☆☆☆ Found in Text Mining only
Cyclical vomiting syndrome (disorder)	Cyclical Vomiting Syndrome	BEFREE	23555845, 27633189, 29434735		★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	16213873, 28678970, 28821422		★☆☆☆☆ Found in Text Mining only
Cystic Disease Of Lung	Cystic lung disease	Pubtator	20111696	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Disease Of Lung	Cystic lung disease	Pubtator	25545245	Stimulate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	17186573, 21743026, 27349634, 28068000, 28381428, 29703589, 31176670, 31474496		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	LHGDN	17384080		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	17384080, 20111696, 21743026, 33920274	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	19604728	Stimulate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	30177416, 37686190	Inhibit	★☆☆☆☆ Found in Text Mining only
Deafness	Deafness	Pubtator	33787399, 35061219	Associate	★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	BEFREE	23490413		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	11285370, 12939660, 14730609, 15107580, 16200590, 16507143, 17498959, 18802702, 19765281, 21854562, 26409848, 26577236, 26600476, 28049462, 28072480, 28223125, 28442110, 28573370, 28662337, 28987943, 30542428, 30707846, 31298308, 31575035, 9066532		★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	28561062		★☆☆☆☆ Found in Text Mining only
Delirium, Dementia, Amnestic, Cognitive Disorders	Delirium, Dementia, Amnestic, Cognitive Disorders	BEFREE	28487203		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	14550924, 30412498		★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	17077200, 25024308, 27937042		★☆☆☆☆ Found in Text Mining only
Dental Caries	Dental caries	Pubtator	32398053	Associate	★☆☆☆☆ Found in Text Mining only
Dentinogenesis Imperfecta	Dentinogenesis Imperfecta	BEFREE	28195206		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	18980978	Stimulate	★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	20161799, 25153995, 31564697	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	26856768, 27098106, 27434116, 31564697		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	LHGDN	16919028		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	17597813, 28594010, 28987294, 29157812		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	21777517, 34678092	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Herpetiformis	Dermatitis herpetiformis	Pubtator	22991566	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	28586781		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	15841177		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	11157561		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	LHGDN	16097959		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	39808289	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	12164930, 12801609, 16023759, 20571492, 21933988, 25064116, 26599598, 26718502, 26843101, 29244109, 29261844, 29393403, 29748291		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	12164930, 12801609, 16023759, 17275003, 19283512, 20571492, 20960272, 21933988, 22171077, 25064116, 26599598, 26718502, 26843101, 26923392, 28747453, 29244109, 29261844, 29393403, 29748291, 29896433, 29974394, 31295411		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	15215172, 16778129, 20348234, 28789657	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	19074676	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	20215707, 22055260, 22688339, 23106921, 29952417, 29992758, 31012282, 31653825, 33579197, 34054346, 36064844, 36424752, 37905646	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	20960272, 25607396, 35381625	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	16778129, 20215707, 26190179, 32925069, 33742062, 37556419, 39176085	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	17714581, 27771154	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	20960272, 28550760		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	11576356, 16023759, 18587729, 19909726, 20571492, 23229548, 24043671, 26483547, 26923392, 27631001, 28521406, 28964682, 29865065, 29957017, 30302090, 30367022, 30557881, 30564523, 31355267		★☆☆☆☆ Found in Text Mining only
Diabetic Amyotrophy	Diabetic Amyotrophy	CTD_human_DG	20213226		★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic angiopathies	Pubtator	40724896	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Asymmetric Polyneuropathy	Diabetic Asymmetric Polyneuropathy	CTD_human_DG	20213226		★☆☆☆☆ Found in Text Mining only
Diabetic Autonomic Neuropathy	Diabetic Autonomic Neuropathy	CTD_human_DG	20213226		★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	25064116		★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic foot	Pubtator	22688339, 23163982, 31184591	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Ketoacidosis	Diabetic Ketoacidosis	BEFREE	26492282, 26843101, 30986397		★☆☆☆☆ Found in Text Mining only
Diabetic Ketoacidosis	Diabetic ketoacidosis	Pubtator	26843101, 30986397	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Mononeuropathy	Diabetic Mononeuropathy	CTD_human_DG	20213226		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	11576356, 19357773, 23037158, 26184271, 27631001, 29123184, 29952417, 32957381	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	11576356, 17263765, 18587729, 19357773, 20960272, 21824169, 24670409, 26184271, 26924185, 27121697, 27631001, 28584626, 28805677, 29123184, 29233785, 29436620, 29952417, 30049003, 30557881, 30564523		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	LHGDN	18428024		★☆☆☆☆ Found in Text Mining only
Diabetic Neuralgia	Diabetic Neuralgia	CTD_human_DG	20213226		★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic Nephropathy	CTD_human_DG	20213226		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Polyneuropathies	Diabetic polyneuropathy	CTD_human_DG	20213226		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	21567393, 21933988, 23423566, 26025281, 26599598, 28124145, 28478229, 28639050, 28662829, 29285153, 30215334, 31496691		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	32117292	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	33683746	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diarrhea	Diarrhea	Pubtator	30227886	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Astrocytoma	Astrocytoma	CTD_human_DG	20188714		★☆☆☆☆ Found in Text Mining only
Dissecting aortic aneurysm	Dissecting Aortic Aneurysm	BEFREE	9502412		★☆☆☆☆ Found in Text Mining only
Dissection of aorta	Aortic dissection	BEFREE	24487965, 28286334, 29104105, 29589594, 30333305, 30372831, 31672577, 9502412		★☆☆☆☆ Found in Text Mining only
Diverticular Diseases	Diverticular Diseases	BEFREE	21678108		★☆☆☆☆ Found in Text Mining only
Diverticulitis	Diverticulitis	BEFREE	21678108		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	15389712, 29342922		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dry Eye Syndromes	Dry Eye Syndromes	BEFREE	15316122, 22520332, 25240629, 27914947, 28534808, 29135567, 31073413		★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry eye syndrome	Pubtator	21245952, 37055446, 37354028	Associate	★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry eye syndrome	Pubtator	25703476, 31010136, 34012227	Stimulate	★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	24099425, 30074136		★☆☆☆☆ Found in Text Mining only
Dupuytren Contracture	Dupuytren contracture	Pubtator	22987740	Associate	★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	27558929		★☆☆☆☆ Found in Text Mining only
Dyssegmental dysplasia	Dyssegmental dysplasia	Pubtator	12568417	Associate	★☆☆☆☆ Found in Text Mining only
Early infantile epileptic encephalopathy with suppression bursts	Epileptic Encephalopathy	BEFREE	29422250		★☆☆☆☆ Found in Text Mining only
Eating Disorders	Eating Disorders	BEFREE	27891714		★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	18651887, 23387490, 31582211		★☆☆☆☆ Found in Text Mining only
Ectopia Lentis	Ectopia lentis	Pubtator	31180551	Associate	★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	28586781, 29168291		★☆☆☆☆ Found in Text Mining only
Edema	Edema	Pubtator	23742289, 24067772	Associate	★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	12842807, 18723334, 19605697, 21429222, 23734748, 25635861, 27313452, 28254114	Associate	★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	27446965, 30781876	Stimulate	★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	21376661, 29796990		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	Pubtator	36528170	Associate	★☆☆☆☆ Found in Text Mining only
Enchondroma	Enchondroma	BEFREE	19896699		★☆☆☆☆ Found in Text Mining only
Endocarditis	Endocarditis	BEFREE	11400152		★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	30139240		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	10469168, 11920503, 14719079, 19539355, 22674412, 22964525, 23221126, 25308734, 26277400, 28273643, 28402926, 28790116, 29089666, 29254290, 29254314, 29673672, 29805589		★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial hyperplasia	Pubtator	19249761, 30139240	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	11163831, 11920503, 12631221, 17150964, 18644593, 22640183, 22674412, 22964525, 23099861, 23221126, 25308734, 26591688, 26815505, 27051050, 30139240, 31127027, 31894279, 33072202, 34761584, 36807337	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	11920503, 14719079, 17624083		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	26722547	Stimulate	★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	BEFREE	11895472, 22495744, 29300932		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	11163831, 18554596, 20100617, 20378112, 23557756, 23979130, 26289107, 26722547, 27939762, 28537685, 29304094, 29673672, 30777471, 30981279, 31173276, 32698139, 33249961, 33723310, 34247803, 34913072	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	12034345, 12587534, 16192641, 16880228, 17888430, 18295959		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	12107265, 12587534, 16192641, 16455621, 18554596, 19661147, 20081876, 20100617, 21150162, 22495744, 23626717, 26888969, 26965430, 27939762, 28030938, 28537685, 29304094, 29309889, 29673672, 30421503, 30777471, 30981279, 31173276, 31727934		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	16192641	Inhibit	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	17888430, 23626717, 33072202	Stimulate	★☆☆☆☆ Found in Text Mining only
Enteritis	Enteritis	BEFREE	28526636		★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa Dystrophica	Dystrophic epidermolysis bullosa	Pubtator	12880418	Associate	★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa Simplex	Epidermolysis Bullosa Simplex	BEFREE	23894602		★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa Simplex	Epidermolysis bullosa	Pubtator	23894602	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	26525923, 27505431, 29632167, 30915602, 30952062		★☆☆☆☆ Found in Text Mining only
Epilepsy Idiopathic Generalized	Epilepsy	Pubtator	26608825	Stimulate	★☆☆☆☆ Found in Text Mining only
Epilepsy Temporal Lobe	Temporal lobe epilepsy	Pubtator	20605480, 26442541, 39612636	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	20605480, 30343368		★☆☆☆☆ Found in Text Mining only
Epiphyseal dysplasia multiple 1	Epiphyseal dysplasia	Pubtator	36565196	Associate	★☆☆☆☆ Found in Text Mining only
Episodic Kinesigenic Dyskinesia 1	Episodic Kinesigenic Dyskinesia	BEFREE	28506758, 31572058		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	23580092, 28859117, 29113212, 30952722		★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	10995877, 22288519		★☆☆☆☆ Found in Text Mining only
Esophageal Achalasia	Achalasia	BEFREE	30449890		★☆☆☆☆ Found in Text Mining only
Esophageal Achalasia	Esophageal achalasia	Pubtator	30449890	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal and Gastric Varices	Esophageal and gastric varices	Pubtator	30392570	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	24789592, 25213700, 26202395, 28231690		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	LHGDN	19141401		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	19141401, 25966235, 31324733, 35315581, 37753805	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	24789592, 25213700, 28231690		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	14569466, 15682484, 17412867, 20920372, 22433565, 24351116, 25391977, 25966235, 26190820, 27689325, 28423526, 29693138, 30280774, 32825936, 33149553, 33572115, 33909822, 36259348, 37753805	Associate	★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	17581602, 22906271		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	22574960	Stimulate	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	29039470, 29435061		★☆☆☆☆ Found in Text Mining only
Exfoliation Syndrome	Exfoliation Syndrome	BEFREE	20808730, 28586796		★☆☆☆☆ Found in Text Mining only
Exudative age-related macular degeneration	Exudative Macular Degeneration	BEFREE	25162123		★☆☆☆☆ Found in Text Mining only
Factor XIII Deficiency	Factor xiii deficiency	Pubtator	31469059	Associate	★☆☆☆☆ Found in Text Mining only
Fallopian Tube Carcinoma	Fallopian Tube Carcinoma	BEFREE	26785083		★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	24453046		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	25358651, 28098879		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi anemia	Pubtator	34954697	Associate	★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	25358651, 28098879		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	21791204		★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	21791204, 29515450		★☆☆☆☆ Found in Text Mining only
Febrile Convulsions	Febrile seizures	LHGDN	17928006		★☆☆☆☆ Found in Text Mining only
Febrile Convulsions	Febrile seizures	BEFREE	21376661		★☆☆☆☆ Found in Text Mining only
Fibrillary Astrocytoma	Fibrillary Astrocytoma	CTD_human_DG	20188714		★☆☆☆☆ Found in Text Mining only
Fibroadenoma	Fibroadenoma	BEFREE	31839881		★☆☆☆☆ Found in Text Mining only
Fibromyxosarcoma	Fibromyxosarcoma	BEFREE	23549872		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	10597035, 1400481, 15107580, 1653238, 1662501, 17091328, 17498959, 19910495, 21461577, 2169729, 21937212, 22194464, 24246676, 25518925, 25912851, 26176658, 27476935, 29518973, 30519264, 8625299, 9103395, 9488041		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	LHGDN	12606037, 19208844		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	15479690, 16507762, 22065159, 24104560, 24976518, 25380300, 27260943, 27907201, 28548299, 29989076, 30019784, 31262748, 31638220		★☆☆☆☆ Found in Text Mining only
Focal Emphysema	Emphysema	CTD_human_DG	25106431		★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	17205957		★☆☆☆☆ Found in Text Mining only
Follicular adenoma	Adenoma	BEFREE	16430475, 22280229		★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	17397984, 22280229		★☆☆☆☆ Found in Text Mining only
Fragile X Syndrome	Fragile X Syndrome	BEFREE	20643379, 25466251, 26525923, 29040407, 30123106, 30414172, 31128097, 31271818		★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	27594586, 30412498		★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	27594586	Associate	★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	24438533, 24863943, 25970782, 28194091, 31517732		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	24863943, 25970782, 29034777	Associate	★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	36656209	Stimulate	★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	19680827, 24481712		★☆☆☆☆ Found in Text Mining only
Gastric ulcer	Gastric ulcer	CTD_human_DG	17603938		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastritis	Gastritis	BEFREE	12671895, 20333791		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	20333791, 34471638, 37958643	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis Atrophic	Gastritis	Pubtator	29963765	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	29963765		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	9836483	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	10450179	Stimulate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	22489693, 30534358		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	24935368	Associate	★☆☆☆☆ Found in Text Mining only
Gemistocytic astrocytoma	Gemistocytic Astrocytoma	CTD_human_DG	20188714		★☆☆☆☆ Found in Text Mining only
Geographic Atrophy	Geographic Atrophy	BEFREE	29346644, 30288950		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	LHGDN	15998676, 18512818		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	17502363, 18512818, 29970365, 8843867		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Giant Cell Arteritis	Giant cell arteritis	Pubtator	17502363, 18512818, 34204585	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Giant Cell Arteritis	Giant cell arteritis	Pubtator	37703805	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Giant Cell Glioblastoma	Giant Cell Glioblastoma	CTD_human_DG	16598420		★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	BEFREE	12850503, 26261481, 27384731, 29600575, 30675196, 8030443, 9219728, 9917505		★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	Pubtator	27384731, 8579123	Associate	★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Tendon Sheath	Giant cell tumor of tendon sheath	Pubtator	38017559	Associate	★☆☆☆☆ Found in Text Mining only
Gingival Hypertrophy	Gingival diseases	Pubtator	21424088	Associate	★☆☆☆☆ Found in Text Mining only
Gingival Recession	Gingival Recession	BEFREE	25738347		★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingivitis	BEFREE	18930181, 28351517, 28598286		★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingival diseases	Pubtator	30327948, 32130362	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	26120586, 29432439, 31713905	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	26872021, 28431514, 28586796, 30591791, 30668341, 31268809, 31713905		★☆☆☆☆ Found in Text Mining only
Glaucoma 3 Primary Congenital A	Glaucoma	Pubtator	29432439	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma Angle Closure	Angle closure glaucoma	Pubtator	17110919, 18323704, 19633731, 21655354, 23378726, 23441116, 29432439, 31713905	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	18323704, 20808730, 22605928, 23441116, 23800300, 26120586, 26539028, 29432439, 31713905	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	25312247, 26120586, 32472047	Stimulate	★☆☆☆☆ Found in Text Mining only
Glaucoma, Open-Angle	Glaucoma	BEFREE	20808730		★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	20808730, 21348595, 22605928, 23441116, 23800300, 26539028, 29199866, 29432439, 31073413		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	11156378, 11315098, 11398836, 12165859, 12414663, 12750266, 12918061, 15122332, 16901352, 19176371, 19187648, 19567589, 20413683, 20458747, 20716639, 21831363, 22024282, 22711523, 23076139, 24771221, 24867100, 25256634, 25326894, 27039805, 27225222, 27621042, 28036297, 28112361, 28191466, 28454256, 28927111, 29029486, 29187298, 29961065, 29977365, 30431227, 30571666, 30834619, 31028823, 31106423, 8521611, 9708803		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma	Glioblastoma	Pubtator	12918061, 16901352, 19176371, 19657395, 22773464, 24771221, 24867100, 25349993, 25825051, 26299938, 26450124, 26474590, 27022952, 27363017, 28191466, 28600709, 29538296, 30353649, 31142630, 32074974, 32231148, 34345995, 35682709, 36400876, 38174685, 39684754	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma	Glioblastoma	LHGDN	15122332, 18355442, 18942717, 19176371		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma	Glioblastoma	CTD_human_DG	16598420		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma	Glioblastoma	Pubtator	32033611	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma Multiforme	Glioblastoma	BEFREE	11156378, 11315098, 12165859, 12231534, 12414663, 12750266, 15122332, 19176371, 19187648, 19567589, 20413683, 20458747, 20716639, 21831363, 22024282, 22711523, 23076139, 23183822, 24771221, 24867100, 25256634, 25326894, 27039805, 27225222, 27621042, 28112361, 28191466, 28454256, 28454354, 28927111, 29029486, 29156757, 29187298, 29338907, 29961065, 29977365, 30431227, 30470262, 30571666, 30834619, 31028823, 31106423, 8521611		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	CTD_human_DG	16598420		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	10206300, 10638966, 11302334, 18813792, 18974397, 19383369, 19657395, 19724922, 20511184, 20838853, 21166955, 22773464, 22967049, 23076139, 23893382, 24286317, 24587321, 24833088, 24913705, 26328748, 26473829, 26502849, 26617746, 26722455, 27022952, 27287871, 27334625, 27589728, 27943225, 28506595, 28849217, 28901452, 30178845, 30373180, 31115528, 31414734, 31545229, 33694259, 33919449, 35581384, 37587889, 9593690	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	10571406, 11409528, 12165859, 12750266, 16773187, 17880928, 18802741, 20388776, 20463757, 20657647, 21855630, 23076139, 23183822, 23893382, 24325546, 24418124, 24752463, 25470344, 25622756, 25954855, 26165699, 26722455, 26936647, 27022952, 27589728, 27686608, 28265824, 28454256, 28591697, 28849217, 28969029, 29035824, 29156757, 29201025, 30178845, 30373180, 31115528, 31545229, 31754182, 7616276		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	17020973, 17437609, 18070596		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	36400876	Stimulate	★☆☆☆☆ Found in Text Mining only
gliosarcoma	Gliosarcoma	BEFREE	22288519		★☆☆☆☆ Found in Text Mining only
Gliosarcoma	Gliosarcoma	Pubtator	22288519	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	11014984, 28584626, 8712219		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	LHGDN	17205957		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	Pubtator	22845765	Inhibit	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	20529817, 31726998	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	25806402	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis, Membranoproliferative	Glomerulonephritis	BEFREE	28584626		★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	28645189		★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid Receptor Deficiency	BEFREE	28035377		★☆☆☆☆ Found in Text Mining only
Glycogen storage disease type II	Glycogen Storage Disease	BEFREE	28765149		★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type II	Glycogen storage disease	Pubtator	33907369	Associate	★☆☆☆☆ Found in Text Mining only
Grade I Astrocytoma	Grade I Astrocytoma	CTD_human_DG	20188714		★☆☆☆☆ Found in Text Mining only
Granulomatosis with polyangiitis	Granulomatosis With Polyangiitis	BEFREE	31798577		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	29521049		★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	33498689	Stimulate	★☆☆☆☆ Found in Text Mining only
Gray Platelet Syndrome	Gray Platelet Syndrome	BEFREE	29930006		★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome	Guillain-Barre Syndrome	BEFREE	17761309		★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	28391416		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	31656199		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	32603365	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	11078794, 12404284, 20360147, 21380786, 23122824, 23349315, 23637955		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	12404284, 34768995, 36674806	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	21108787	Stimulate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	19264454, 19536654, 20197064, 21437990, 29050751		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	23139380, 23535507, 30674924, 33920274, 36867212, 38379280	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	12381651, 16202218	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	16406300, 16574429, 25064116, 26112171, 28399617, 28523165, 28772055, 29663512, 29904410, 30353496, 30965053, 31053170, 31099017, 31782085		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	LHGDN	17889183		★☆☆☆☆ Found in Text Mining only
Heart Valve Diseases	Heart valve disease	Pubtator	36565196	Associate	★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	BEFREE	30070315		★☆☆☆☆ Found in Text Mining only
Hemangioma capillary infantile	Capillary infantile hemangioma	Pubtator	30070315	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	30747385		★☆☆☆☆ Found in Text Mining only
Hematoma	Hematoma	Pubtator	24067772	Associate	★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	Pubtator	22608171	Associate	★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	Pubtator	23287320	Stimulate	★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	11172829, 18037806, 23742289, 25858502, 31074588	Associate	★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	15215164, 36674806	Stimulate	★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	19353331	Inhibit	★☆☆☆☆ Found in Text Mining only
Hemorrhagic Stroke	Hemorrhagic stroke	Pubtator	18342317	Associate	★☆☆☆☆ Found in Text Mining only
Hemorrhagic Stroke	Hemorrhagic stroke	Pubtator	21707819	Stimulate	★☆☆☆☆ Found in Text Mining only
Henoch-Schoenlein Purpura	Henoch-Schonlein Nephritis	BEFREE	27323137		★☆☆☆☆ Found in Text Mining only
Hepatic Veno Occlusive Disease	Hepatic veno occlusive disease	Pubtator	26790967	Associate	★☆☆☆☆ Found in Text Mining only
Hepatic Veno-Occlusive Disease	Hepatic veno-occlusive disease-immunodeficiency syndrome	BEFREE	29774103		★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	25299117, 35868407	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	28122987	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	25299117	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	15479690, 36003399	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	20835647, 28961241, 29636110	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Factor XIII Deficiency	Hereditary Factor XIII Deficiency	BEFREE	31469059		★☆☆☆☆ Found in Text Mining only
Hereditary gingival fibromatosis	Hereditary Gingival Fibromatosis	BEFREE	18789327		★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Hereditary Pancreatitis	BEFREE	31258660		★☆☆☆☆ Found in Text Mining only
High Grade Lymphoma (neoplasm)	High Grade Lymphoma	BEFREE	8369572		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	10477738, 1402008, 9653834		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	10897334, 21454882, 24086377, 28791394, 35868407	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	LHGDN	12431239		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	19590393, 29459817, 9653834		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	Pubtator	29291905	Associate	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia, Familial	Hypercholesterolemia	LHGDN	16280123		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia, Familial	Hypercholesterolemia	BEFREE	23131422		★☆☆☆☆ Found in Text Mining only
Hyperemia	Hyperemia	BEFREE	29752550		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	17272778, 25064116, 28624040, 28989027, 29115516, 29856477, 29890158, 30703289		★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	11254667, 16896935, 21802713, 31377002		★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	Pubtator	22275073	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	Pubtator	36424752	Associate	★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	27659153, 29372034, 30373522		★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type IIa	Hyperlipoproteinemia	BEFREE	23131422		★☆☆☆☆ Found in Text Mining only
Hyperoxia	Hyperoxia	Pubtator	27925619	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism Primary	Hyperparathyroidism	Pubtator	21698093	Associate	★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	36867212	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertension	Hypertension	Pubtator	18647135, 20211160, 20707992, 21430243, 21887284, 33579197, 37905646	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertension	Hypertension	Pubtator	22906271, 32164582, 35439345	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertension	Hypertension	Pubtator	33760199	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	LHGDN	15363817, 15556929, 17581602		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	BEFREE	18647135, 19339995, 19355890, 20150548, 20577123, 20707992, 21887284, 21963461, 22906271, 23248206, 25416694, 26637202, 27558929, 28034583, 28726716, 28747453, 29518381, 29693002, 30373522, 31200003, 31258700, 31473513, 31630227		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	CTD_human_DG	21051829		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	28361263, 30323866		★☆☆☆☆ Found in Text Mining only
Hypertrophic obstructive cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	30323866		★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	21424088, 25611292	Associate	★☆☆☆☆ Found in Text Mining only
Hypertrophy Left Ventricular	Left ventricular disease	Pubtator	19815660, 20707992, 21350055, 21890325	Associate	★☆☆☆☆ Found in Text Mining only
Hypertrophy Left Ventricular	Left ventricular disease	Pubtator	29035099	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	16259004, 30468453, 32096196, 37885015	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	17099219, 17273772, 20491781, 21338440, 23289374, 23307318, 25168373, 26286316, 27581620, 29218693, 29243776, 31618079, 33136275, 33811221, 36285283, 9500201	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	35163668	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	30586599		★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	10971173, 17077165		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	18355767, 21063214, 29913136, 30031694, 30036135		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	10226060, 26121236, 26401883, 28178340, 28254114		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	15879152, 18723334, 33672678	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	18829682, 28178340	Stimulate	★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	LHGDN	11940298		★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	28584626, 8712219		★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	31053569		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	23022495		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	28881691, 29306898, 29901198, 30877026, 31185379, 31555105		★☆☆☆☆ Found in Text Mining only
Inclusion Body Myositis (disorder)	Inclusion Body Myositis	BEFREE	11157561		★☆☆☆☆ Found in Text Mining only
Infantile hemangioma	Hemangioma	BEFREE	30070315		★☆☆☆☆ Found in Text Mining only
Infarction, Middle Cerebral Artery	Cerebral Infraction	CTD_human_DG	19309543		★☆☆☆☆ Found in Text Mining only
Inflammatory abnormality of the eye	Inflammatory abnormality of the eye	BEFREE	31010136, 31073413		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	11244573, 15869913, 16344067, 27542125, 28561062, 28723856, 30543452, 31652976		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	LHGDN	12651627		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	19137636, 31652976, 32466182, 35452485	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	30543452, 33826658, 39712025	Stimulate	★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	17597813, 28594010, 28987294, 29157812		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	20392866, 22471305, 38034020	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	19444758, 26656045, 28551829		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	23807291, 33764282	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral disc disease	Intervertebral disc disease	Pubtator	18455130, 29028103, 40016774	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Displacement	Intervertebral disc displacement	Pubtator	32312031	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Cancer	Intestinal Cancer	BEFREE	17059590		★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	10582986, 15214991, 16961137, 29518381, 30121455, 30542399, 30808715		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	18239167, 23516489	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intracranial Arteriovenous Malformations	Intracranial arteriovenous malformation	Pubtator	15667660	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Arteriovenous Malformations	Intracranial arteriovenous malformation	Pubtator	27075045, 29052569	Stimulate	★☆☆☆☆ Found in Text Mining only
Intracranial Astrocytoma	Intracranial Astrocytoma	CTD_human_DG	20188714		★☆☆☆☆ Found in Text Mining only
Intracranial Hemorrhage Traumatic	Intracranial hemorrhage	Pubtator	24067772	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Hemorrhages	Intracranial hemorrhage	Pubtator	31469059	Associate	★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	26014518, 31692584		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholestasis of Pregnancy	Intrahepatic cholestasis of pregnancy	Pubtator	28233754	Stimulate	★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	24236052, 27032379, 28521406		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	29698332	Associate	★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	31652976		★☆☆☆☆ Found in Text Mining only
Ischemic Attack Transient	Transient ischemic attack	Pubtator	35620813	Stimulate	★☆☆☆☆ Found in Text Mining only
Ischemic Attack Transient	Transient ischemic attack	Pubtator	37547382	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	20827608, 22591946, 23780386, 24771042, 26617904, 26782596, 28063771, 28258806, 28722240, 28747453, 29306898, 29598905, 29618156, 29724240, 29875068, 29906531, 29916544, 30132967, 30257242, 30287248, 30484473, 30552827, 30911000, 30992065, 31012282, 31074588, 31185379, 31415895, 31564697		★☆☆☆☆ Found in Text Mining only
Ischemic Stroke	Ischemic stroke	Pubtator	37338050	Associate	★☆☆☆☆ Found in Text Mining only
Isolated Systolic Hypertension	Isolated systolic hypertension	Pubtator	23794948	Associate	★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	20596903, 29240923, 31781639		★☆☆☆☆ Found in Text Mining only
Juvenile Pilocytic Astrocytoma	Astrocytoma	CTD_human_DG	20188714		★☆☆☆☆ Found in Text Mining only
Keratitis	Keratitis	Pubtator	28573109	Associate	★☆☆☆☆ Found in Text Mining only
Keratoconjunctivitis Sicca	Keratoconjunctivitis Sicca	BEFREE	15316122, 30804658		★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	BEFREE	25593510, 25648341, 28197741, 30804658, 31363950, 31397194		★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	25593510, 30804658, 36051483	Associate	★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	29021606, 39424461	Stimulate	★☆☆☆☆ Found in Text Mining only
Kidney Calculi	Kidney stone	BEFREE	28205286, 28336462		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	12830465, 17205957, 18587729, 19357773, 20960272, 23128247, 24670409, 27323137, 30367022		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	LHGDN	16313894		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	17898039, 19357773, 20960272, 37905646	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	12830465		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	16202218, 23010359, 37439962	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	29856477, 31132220		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	12830465, 23010359, 29891747, 30035656, 30557881, 31722350		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	11159211, 17541305		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	11159211, 17541305, 33059651, 35399832, 36674555	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	24357157, 31143300, 31364124, 31882488, 32719260, 36701711	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	15746850, 16265652, 19093256, 27533461, 31110546, 31143300		★☆☆☆☆ Found in Text Mining only
Laryngitis	Laryngitis	Pubtator	24175817	Associate	★☆☆☆☆ Found in Text Mining only
LAURIN-SANDROW SYNDROME	Laurin-Sandrow syndrome	BEFREE	29749498		★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	19815660, 20707992, 21890325, 27825280, 29035099		★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	23814095, 28929861, 29747655	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	23661254	Associate	★☆☆☆☆ Found in Text Mining only
LEOPARD Syndrome	Leopard syndrome	Pubtator	16202218, 31112872	Associate	★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	20008541	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10650782, 22614916, 22865631, 26260845		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	15385961, 15388891, 18326820, 23349302, 24008270, 24606444, 29883990	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	18414048		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	20224727	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	10233411, 11736941, 23085464, 23919981, 27039800, 28298217, 39251712	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10353746, 10650782, 11380392, 14630085, 18081721, 23085464, 25246708, 25955299, 27039800, 28298217, 30747385		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	18081721		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	11830485, 25189759		★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	28947666		★☆☆☆☆ Found in Text Mining only
Leukoplakia	Leukoplakia	BEFREE	18597705		★☆☆☆☆ Found in Text Mining only
Leukoplakia, Oral	Leukoplakia	BEFREE	18597705, 29964301		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	26938614		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy body disease	Pubtator	26938614	Associate	★☆☆☆☆ Found in Text Mining only
Linear atrophy	Atrophy	BEFREE	28627704, 31470202		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	17498910, 18234959, 20040021, 26036622, 28160595, 29996471, 30639311		★☆☆☆☆ Found in Text Mining only
Lipoid nephrosis	Lipoid Nephrosis	BEFREE	28584626		★☆☆☆☆ Found in Text Mining only
Lipoid Proteinosis of Urbach and Wiethe	Lipoid Proteinosis	BEFREE	16512877, 26564090		★☆☆☆☆ Found in Text Mining only
Liposarcoma	Liposarcoma	Pubtator	11249053, 23661254, 24085323	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10914717, 11561728, 12464265, 12745093, 16732316, 16763805, 17051636, 17452979, 17464423, 17543481, 18177474, 18497990, 18584487, 18636172, 18835982, 19065669, 19110045, 19418353, 19465902, 20023698, 20219012, 20305690, 21102517, 21409686, 21667159, 21671467, 21681821, 21717246, 21842128, 22289527, 22363545, 22427881, 22472882, 22546345, 23050001, 23232575, 23569130, 23670717, 23742776, 23807724, 24065232, 24078466, 24284889, 24841638, 25142974, 25173640, 25299117, 25305454, 25607810, 25626059, 25999065, 26194347, 26551737, 27267910, 27853186, 28122987, 28337887, 28357609, 28911005, 29069753, 29375378, 29439451, 29466986, 30070322, 30087833, 30237394, 30333881, 30817182, 30925457, 31044528, 31086224, 31126682, 31281549, 31387985, 31499614, 31599408, 31646557, 31773692, 8690399, 8952517		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	12745093, 16732316, 17049831, 17564313, 18426080, 18835982, 19110045		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	20084675		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	15479690	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	15955221, 19465902, 21849805, 28607529		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	36773569	Associate	★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	15479690	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Diseases Alcoholic	Liver disease	Pubtator	26097608	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	16291395	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	21681821, 24841638, 25305454		★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	24068394	Associate	★☆☆☆☆ Found in Text Mining only
Low Tension Glaucoma	Low Tension Glaucoma	BEFREE	14704547, 29199866		★☆☆☆☆ Found in Text Mining only
Lumbar disc disease	Lumbar Disc Disease	BEFREE	19444758		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	12456387, 29739412, 31600735, 33920274	Associate	★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	12495928, 19097983, 19596921, 27155366, 28662821, 30568032		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	LHGDN	12663332, 12712078, 16155381		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	32396269, 39625996	Stimulate	★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	16867869, 20360623, 39808289	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	31440381		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	LHGDN	11935310, 14981939, 15824527, 15935515, 16061858, 17018612, 17916907, 18194466, 18288638		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	11935310, 16882662, 18288638, 19270647, 19568240, 19619798, 21525012, 22158108, 22455335, 23681803, 23801886, 24621612, 25266803, 25605200, 26198673, 26230665, 26498639, 26608367, 26739332, 27127879, 28272723, 28350337, 28677797, 29565268, 30060029, 30078010, 30889876, 31034948, 31081094, 31298335, 32396269, 33629306, 34209215, 35178453, 35422093, 35898682, 37445754	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	16882662, 25038189, 25703655, 28230260, 28633995, 30147314, 30157785		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	22593690	Inhibit	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	28202627	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	25416694, 26403095		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	12890748, 18652766, 21436623, 33093251, 35972968	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	15535833, 34180358	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	25416694, 26403095		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	12791318, 16652230, 17488482, 18571010, 18652766, 25416694, 26403095, 29879882, 30358100, 30561224, 30967870		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	15022328, 17488482, 18652766		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	CTD_human_DG	22479529		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Nephritis	Lupus Nephritis	BEFREE	28584626		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Nephritis	Lupus nephritis	Pubtator	40045202	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Vulgaris	Lupus Vulgaris	BEFREE	25416694, 26403095		★☆☆☆☆ Found in Text Mining only
Lymphangioleiomyomatosis	Lymphangiomyomatosis	BEFREE	29739412		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	10424737, 14647147, 15362205, 16237750, 17094486, 17465457, 17729419, 18296264, 19141401, 19906411, 22126484, 22289522, 22471461, 22674412, 23132676, 24312291, 24357157, 24476461, 24778099, 24793016, 24993803, 25268950, 25973085, 26014518, 28621235, 28751724, 30010105, 32521887, 33629306, 33763485, 33819484	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	15682484, 16203990, 20534121, 21089052, 24845596, 26656588, 28316326, 28423526, 28459196, 31510782	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	15949868, 17465457, 17729419, 20609636, 21089052, 29254290, 29254314		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	11590195, 19391040, 20472833, 30779087, 8369572, 9520415		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	18636124		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	31210316	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	9520415	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	35965624	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	21926965		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	17363605, 18636124		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	17363605		★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	26691988, 32155173, 33907369, 35181781	Associate	★☆☆☆☆ Found in Text Mining only
Macular Edema, Cystoid	Cystoid macular edema	BEFREE	22773904		★☆☆☆☆ Found in Text Mining only
Macular retinal edema	Macular edema	BEFREE	22773904		★☆☆☆☆ Found in Text Mining only
Malignant Bone Neoplasm	Malignant Bone Neoplasm	CTD_human_DG	16475674		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	10206300, 20188714, 8521611		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	11078794, 20360147, 21380786, 23349315, 23637955		★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	30226602		★☆☆☆☆ Found in Text Mining only
Malignant Meningioma	Malignant Meningioma	BEFREE	17549400, 17912429		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	31191742		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11288958, 11781819, 12000221, 12825860, 15075244, 15538048, 15609121, 16158251, 16243823, 16267613, 16836568, 17651959, 17657740, 17683926, 17828308, 18172859, 18243246, 18451168, 18483307, 18519796, 18644862, 18821062, 19035293, 19144199, 19889214, 20617371, 20725776, 20821046, 21106094, 21151179, 21170718, 21187089, 21503589, 21666711, 21963718, 22480333, 22542663, 22627808, 22640735, 22853317, 22878890, 22995648, 23151889, 23242121, 23292685, 23353996, 23509357, 23550278, 23570558, 23618129, 23696797, 23750285, 24099425, 24130769, 24152909, 24211352, 24272202, 24337540, 24357512, 24596383, 24811362, 24845596, 24859472, 25075039, 25083991, 25151367, 25213553, 25605249, 25608710, 25659578, 25670016, 25735351, 25811800, 25890491, 26134759, 26608367, 26717978, 26906973, 26976638, 27087131, 27110764, 27697091, 27770930, 27779707, 27810593, 27812894, 27876502, 28212583, 28272917, 28443467, 28730767, 28754674, 28861172, 28910973, 28927117, 28961241, 28970848, 28981380, 28986926, 29107105, 29113219, 29162512, 29371992, 29387062, 29658601, 29684479, 30010105, 30074136, 30141614, 30142200, 30185799, 30194384, 30274515, 30320388, 30500835, 30558648, 30594607, 30993496, 31104011, 31264317, 31265880, 31306109, 31346317, 31409371, 31416219, 31444237, 31528229, 31683960, 31706051, 31814478, 31820313, 31825614, 31839881, 8570199		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	19617202		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	14719079, 19539355, 22674412, 22964525, 23221126, 25308734, 26277400, 28273643, 28790116, 29089666, 29254314, 29673672, 29805589		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	20360147, 24789592, 25213700, 28231690		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	24438533, 24863943, 28194091, 31517732		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	29890308		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	23281640		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	19093256, 30061937, 31143300		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	20885449, 24972653, 25173640, 28357609		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11781819, 11935310, 14981939, 15623631, 15824527, 16061858, 16170032, 17916907, 19619798, 19814619, 20360147, 20392988, 21601305, 21717058, 22158108, 22455335, 22503731, 23313298, 23475608, 23681803, 23801886, 23857284, 24099107, 24366569, 24621612, 25266803, 25703655, 25746000, 26151179, 26198673, 26323669, 26739332, 27127879, 27268917, 27545207, 28202627, 28272723, 28610954, 28677797, 29091292, 29113175, 29387220, 29443542, 29928404, 30214563, 30378152, 30388099, 30431227, 30867776, 30889876, 31034948, 31275410		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	17498910, 17617834, 18234959, 18496150, 20040021, 26036622, 28160595, 29996471, 30639311		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of nasopharynx	Nasopharyngeal carcinoma	BEFREE	17385073, 24218340, 24576804		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	10995877, 15623631, 17475671, 18559505, 21644819, 21676452, 22471482, 22579115, 22832979, 23580092, 25738807, 26168135, 26298390, 28859117, 29461589, 9743290		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	12167581, 12947332, 15257104, 16340751, 16510599, 18397859, 18410405, 19670328, 19908231, 20571492, 21283078, 22159401, 25883224, 26866436, 27459514, 29687228, 30941918, 30958531, 31061236, 7635566		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	CTD_human_DG	22952646		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11477554, 12361907, 12586837, 12840218, 14605668, 15048090, 15356679, 15922868, 16114056, 16619495, 16990429, 17175378, 17409440, 18337451, 18612129, 18615482, 19010864, 19303106, 20160036, 20207476, 20448670, 20550708, 21219645, 21306303, 21391788, 21828059, 22110740, 22200661, 22895549, 23526143, 23708657, 23792449, 24326842, 24360663, 24374826, 24390612, 24453046, 25056536, 25135278, 25310386, 26005860, 26564800, 27355218, 27931798, 28004109, 28237042, 28707808, 29107109, 29167276, 29175302, 29594945, 29650324, 30041429, 30249503, 30464622, 31381135, 31600936, 31660560, 9766654, 9950685		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	16606632		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of salivary gland	Malignant neoplasm of salivary gland	BEFREE	18000467, 27569079		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	CTD_human_DG	18572023		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	19064570		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	15565457, 15929172, 17465457, 17486447, 17617834, 18451255, 20066900, 20333791, 20360147, 20514448, 20559690, 21089052, 21337552, 24185685, 25174603, 25207654, 25253129, 25301736, 25394504, 25398131, 25586465, 25613482, 25627005, 25633484, 25724188, 26156886, 26259977, 26291058, 26362716, 26625734, 27053167, 27154576, 28060752, 28235803, 28459196, 28534934, 29030742, 29228747, 29651326, 29963765, 30192003, 30544870, 30815034, 31026069, 31202170, 31632572, 31681401, 31816819		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of testis	Malignant Neoplasm Of Testis	BEFREE	30924599		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	23150684, 28715683		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of tongue	Malignant Neoplasm Of Tongue	BEFREE	21174909		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	10996723, 11299737, 11555602, 14713761, 17473191, 20068172, 20574775, 20864363, 21351095, 22695075, 22895549, 23819551, 24390660, 24448324, 26069102, 26197083, 27602581, 27631965, 28040581, 28176369, 28356943, 28980922, 29209142, 29237912, 29578150, 30249503, 30526300, 30548095, 31506605, 31705065, 8014015		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	CTD_human_DG	30548095		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10353746, 10914717, 11060311, 11078794, 11781819, 11935310, 12000221, 12165638, 12231534, 12586837, 12771921, 15028476, 15067337, 15157658, 15343380, 15356679, 15469396, 15565457, 15682484, 15824107, 15855236, 15864715, 16061858, 16166639, 16170032, 16466849, 16551873, 16687484, 16840734, 16891410, 16985063, 17059590, 17091328, 17546628, 18062964, 18167127, 18177474, 18347934, 18451255, 18596065, 18834856, 18853186, 18951930, 19010864, 19218340, 19264454, 19301652, 19360311, 19363519, 19480010, 19513513, 19536654, 19541433, 19889214, 19906411, 19923455, 20031158, 20068187, 20197385, 20333791, 20360147, 20373132, 20392988, 20574775, 20609636, 20650348, 20851953, 20864363, 21106094, 21148633, 21199798, 21219645, 21231907, 21391788, 21437990, 21461577, 21717058, 21723221, 21911059, 21993858, 22415092, 22542663, 22928942, 23184252, 23490413, 23563846, 23570558, 23580348, 23615401, 23644699, 24065232, 24190483, 24378964, 24486215, 24526468, 24596383, 24604087, 24632608, 24705809, 24771221, 24804816, 24867100, 25056536, 25151367, 25227664, 25299117, 25326065, 25329315, 25432135, 25476160, 25542236, 25545756, 25735351, 25738807, 25746000, 25797258, 25865774, 25884903, 25937206, 25976379, 25979438, 26050228, 26259977, 26301605, 26418253, 26546437, 26548724, 26625734, 26637202, 26711783, 26852038, 26915610, 27145365, 27384731, 27602581, 27814720, 27829549, 27835571, 27861153, 28004430, 28157665, 28237042, 28264435, 28337319, 28349828, 28369077, 28423526, 28623487, 28661037, 28723167, 28754674, 28927117, 28945333, 28980922, 29068478, 29089666, 29091292, 29112150, 29162510, 29212256, 29310118, 29338907, 29422250, 29473954, 29520667, 29578150, 29588220, 29607933, 29614094, 29620225, 29633599, 29668679, 29684479, 29753168, 29767419, 29794962, 29964301, 29973599, 29983876, 30008898, 30079817, 30240842, 30249503, 30262739, 30281903, 30318526, 30333314, 30340564, 30471427, 30497018, 30500835, 30570882, 30582279, 30591791, 30655899, 30656360, 30668328, 30734664, 30900156, 31092423, 31179226, 31264317, 31311559, 31363054, 31372863, 31423185, 31618079, 31681401, 31719821, 31810917, 31820313, 31825614, 31831717, 7616276, 7669564, 8543396, 8952517, 9818827		★☆☆☆☆ Found in Text Mining only
Malignant Squamous Cell Neoplasm	Neoplasm	BEFREE	14694517, 16699496		★☆☆☆☆ Found in Text Mining only
Malignant Testicular Germ Cell Tumor	Malignant testicular germ cell tumor	BEFREE	30924599		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	12189553, 15343380, 19996286, 24804816, 26526578, 26873866, 28599453, 29767419, 30655899, 31572058		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	14691307, 15588763, 16551873, 17224907, 17332939, 20068187, 20609636, 21866366, 23104504, 23645734, 24085798, 24222121, 24224610, 25326065, 25902005, 26608367, 26648422, 28970726, 29237264, 30129419, 30185549, 30306455, 30349300, 30525244, 30588252, 30734664, 30877036, 8543396		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	CTD_human_DG	15725655		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	31679431		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	19617202		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	11781819, 12219015, 12753719, 12866035, 12874388, 14744773, 15569994, 15609121, 16061852, 16158251, 16267613, 16615109, 16984917, 17033924, 17657740, 17725804, 18438343, 18451168, 18483307, 18644862		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	17657740, 18519796, 18644862, 19144199, 23407024, 24099425, 27554339, 28765266, 29355035, 30558648, 31416219		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	19617202		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	19617202		★☆☆☆☆ Found in Text Mining only
Mandibuloacral dysostosis	Mandibuloacral Dysostosis	BEFREE	18554282		★☆☆☆☆ Found in Text Mining only
Mandibuloacral dysostosis	Mandibuloacral Dysostosis	CTD_human_DG	18554282		★☆☆☆☆ Found in Text Mining only
Mandibuloacral dysplasia with type A lipodystrophy	Mandibuloacral dysplasia	Pubtator	18554282	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Manic	Manic Disorder	BEFREE	24402212		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	30226602		★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan Syndrome	CTD_human_DG	18178469		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Marfan Syndrome	Marfan Syndrome	BEFREE	31340803		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Marfan Syndrome	Marfan syndrome	Pubtator	37445606	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Marfan Syndrome, Type I	Marfan Syndrome	CTD_human_DG	18178469		★☆☆☆☆ Found in Text Mining only
Maternal hypertension	Maternal hypertension	BEFREE	28506758, 28912068, 29569955, 31834839		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	17510426, 21148633, 23728345, 28416738, 9708803		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	21148633, 25736470	Associate	★☆☆☆☆ Found in Text Mining only
Meibomian gland dysfunction	Meibomian Gland Dysfunction	BEFREE	26204109, 29135567		★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	21876460		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	10408860, 10555745, 17346338, 18375955, 21876460, 23728342, 24335752, 25888143, 26390181, 26667022, 27115178, 27210747, 28075446, 28399449, 28440509, 28593604, 29361540, 30154717, 30209062, 31020875, 31075281		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	10844565, 12966436, 16798740, 17346338, 17389601, 21119930, 22843693, 24548268, 24963846, 27115178, 28075446, 28627651, 28699701, 29722524, 30042328, 30072397, 31600735, 32051510, 32134466, 32214200, 32360863, 32510182, 33232779, 33402468, 35011253, 35135212, 35806253, 38527983	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	15604254, 16718267, 17346338, 18045645		★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	28075446, 28796414	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	LHGDN	16722933, 16786122		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	16894529, 19082492, 22420586, 23222509, 23372434, 25400818, 25821815	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	17549400, 17912429, 22995327, 23372434, 25672645, 27757720, 29906745, 30021149		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	26856768, 27098106, 27434116, 31564697		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	26525923		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	11027427	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	LHGDN	17493236		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	21983934, 22371455, 29721201		★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	12612292, 12771921, 19815709, 23563849, 29138529, 31191742	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	25191702, 28763032, 29763368, 38034020	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	25211325	Stimulate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	19575331, 25191702, 25211325, 29763368		★☆☆☆☆ Found in Text Mining only
Metaphyseal anadysplasia	Metaphyseal Anadysplasia	BEFREE	19615667, 24781753, 28342220		★☆☆☆☆ Found in Text Mining only
Metaphyseal anadysplasia	Metaphyseal Anadysplasia	ORPHANET_DG	19615667		★☆☆☆☆ Found in Text Mining only
Metaphyseal anadysplasia	Metaphyseal Anadysplasia	Orphanet			★☆☆☆☆ Found in Text Mining only
Metaphyseal Anadysplasia 2	Metaphyseal Anadysplasia	GENOMICS_ENGLAND_DG	19615667		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Metaphyseal Anadysplasia 2	Metaphyseal Anadysplasia	CTD_human_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Metastatic melanoma	Metastatic Melanoma	BEFREE	16033831		★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	30134822, 31381135		★☆☆☆☆ Found in Text Mining only
Microphthalmos	Microphthalmos	BEFREE	27748762		★☆☆☆☆ Found in Text Mining only
Middle Cerebral Artery Thrombosis	Cerebral Thrombosis	CTD_human_DG	19309543		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	22907074		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	Pubtator	22907074	Associate	★☆☆☆☆ Found in Text Mining only
Miller Dieker syndrome	Miller Dieker Syndrome	BEFREE	31540902		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	33097606	Stimulate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	36199424	Associate	★☆☆☆☆ Found in Text Mining only
Mixed oligoastrocytoma	Oligoastrocytoma	CTD_human_DG	20188714		★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	20008541	Stimulate	★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	30503131, 32461624	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth Neoplasms	LHGDN	17498910, 18234959		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	18234959, 26036622, 26980735, 28638268, 34384424, 36172677, 37641028	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth Neoplasms	BEFREE	29134466		★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya Disease	BEFREE	25280484, 28153617, 29633884		★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya disease	Pubtator	25280484, 38326520	Associate	★☆☆☆☆ Found in Text Mining only
Moyamoya disease 1	Moyamoya disease	BEFREE	25280484, 28153617, 29633884		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	11529928, 16100452, 18091353, 20534943, 26884859, 28977831, 30988740		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	11529928	Stimulate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	LHGDN	12626459		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	16100452, 20534943, 26884859, 34290221, 36829193, 37837870, 38357816, 38427757	Associate	★☆☆☆☆ Found in Text Mining only
Multinodular goiter	Multinodular goiter	BEFREE	30509240		★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia Type 1	Multiple Endocrine Neoplasia	BEFREE	11971760		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	10050721, 10216103, 18812315, 25071016, 26268417, 26601950, 32922167, 36262053, 9269785	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	17854305, 23387827, 26268417, 28035377		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	23387827	Stimulate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	10330301, 10496173, 10626673, 10713364, 10822329, 12020967, 12127674, 12909304, 14607790, 14636780, 15223247, 15265677, 16022584, 16733654, 17655938, 18097882, 18835646, 19383643, 19628284, 19631393, 20471697, 21207142, 22608171, 23897640, 24616914, 24751386, 25670000, 26298319, 27409770, 27630207, 27831901, 28104261, 28681388, 28956834, 29158162, 29687026, 29968546, 31244015, 8957442		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	LHGDN	16042227, 18716555		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	19631393, 22608171, 22879913, 24616914, 24751386, 25468268, 28104261	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	LHGDN	15327032		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	30670793		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophies, Limb-Girdle	Limb-Girdle Muscular Dystrophy	BEFREE	26091074		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy	Muscular dystrophy	BEFREE	19401296		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	25935398, 26091074	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	19401296, 21320869, 24123596, 26091074, 28821969, 29263366, 31699373		★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	11097203	Stimulate	★☆☆☆☆ Found in Text Mining only
Myelodysplasia	Myelodysplasia	BEFREE	23085464		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	16954500, 18081721, 23085464, 27039800, 31540902		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	LHGDN	18081721		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	16954500	Inhibit	★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	23085464, 27039800, 31540902	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	12888904, 17094012, 21288887, 21933581, 23180012, 24825862, 25837664, 26722450		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	25684469		★☆☆☆☆ Found in Text Mining only
Myeloproliferative Disorders	Myeloproliferative disorder	Pubtator	25684469	Associate	★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE SYNDROME, TRANSIENT	Myeloproliferative disorder	BEFREE	27630207		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	16179285, 16254208, 17261792, 17893005, 18342317, 19355890, 21559835, 21733941, 21750701, 21900582, 21963461, 22884843, 24280140, 25153995, 26269290, 26985929, 27824519, 28101856, 28148779, 28193608, 28378397, 28453874, 28642677, 28748762, 29030341, 29232411, 29274308, 29285294, 29387016, 29507703, 29890546, 29949169, 30019466, 30050588, 30244779, 30367841, 30690019, 30763602, 30789913, 30977399, 31035054, 31168029		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	16195613, 25153995	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	CTD_human_DG	16310260, 24358288		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	LHGDN	17126384, 17698228, 17879021		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	21733941, 24040261, 24280140, 25469788, 26985929, 28453874, 29845217, 29949169, 30657570, 32594092, 32916037, 33293800, 33579197, 33847684, 35886020	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	LHGDN	15191941, 18076359		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	BEFREE	16179285		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial ischemia	Pubtator	26190179	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial necrosis	Myocardial necrosis	BEFREE	28642677, 28748762		★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	LHGDN	18444803		★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	20057160		★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	19401296, 21320869, 24123596		★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	BEFREE	19279308, 23077567		★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	Pubtator	23077567	Associate	★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	LHGDN	16097959		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	BEFREE	27117947, 27628627, 31440381		★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	20960272, 22171077	Stimulate	★☆☆☆☆ Found in Text Mining only
MYOTONIC DYSTROPHY 1	Myotonic dystrophy	BEFREE	22171077		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	LHGDN	12589095		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	19958602, 20529372, 23257253, 23987197, 26709128, 28400178, 30239772, 30661312		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	21962096, 23257253, 25973005, 26823777, 30283454, 33982786	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	31893934, 37519135	Stimulate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	10651310, 15229899, 15330177, 17079456, 17385073, 17599818, 19269113, 20534121, 21231907, 22514348, 23277284, 23955812, 24053256, 24218340, 24243817, 24576804, 24603891, 26799856, 27737648, 28380444, 28635400, 29067440, 29854811, 30082032, 31004603, 31289527, 31793355		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	15330177, 15362205, 20534121, 24243817, 24935589, 25031745, 26453114, 26617707, 26715277, 27737648, 28380444, 29228426, 30151927, 33390772, 38050231	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Neoplasms	Nasopharyngeal carcinoma	Pubtator	36225172	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10089944, 10206300, 10537335, 10557095, 10681423, 10741698, 10811139, 10873080, 10914717, 10935492, 11078794, 11220692, 11279604, 11368535, 11395366, 11555602, 11561728, 11583968, 11716547, 11774399, 11920503, 11971760, 12097300, 12114444, 12165638, 12165859, 12231534, 12361907, 12414663, 12438253, 12461330, 12527924, 12590137, 12842087, 12893184, 12941820, 1402008, 14520690, 14605668, 14661062, 14719079, 14978741, 15075244, 15122332, 15123665, 15161022, 15257104, 15319566, 15474669, 15531921, 15538048, 15581944, 15659795, 15833851, 15855236, 15929172, 16170032, 16267613, 16340246, 16357172, 16455304, 16515711, 16551873, 16596214, 16646076, 16687484, 16699496, 16891410, 16914580, 17072348, 17077165, 17131319, 17178855, 17224907, 17330234, 17348445, 17549400, 17617834, 17768685, 17912429, 18062964, 18077379, 18096271, 18172859, 18245496, 18337444, 18347934, 18451168, 18506186, 18519796, 18566996, 18852147, 19073710, 19093256, 19140239, 19218340, 19269113, 19303106, 19482697, 19540207, 19541433, 19596921, 19679556, 19680827, 19793168, 19885951, 19903769, 19933377, 20068187, 20205165, 20332214, 20371289, 20472833, 20530679, 20609636, 20638438, 20662554, 20699364, 20709421, 20864511, 21048031, 21174909, 21199798, 21219539, 21380786, 21604185, 21723221, 21808237, 21855630, 21937212, 22049175, 22104250, 22276166, 22371455, 22382313, 22418433, 22469983, 22514348, 22524830, 22695075, 22729913, 22812190, 22901175, 22917220, 22964525, 22972521, 23001506, 23107277, 23242121, 23281640, 23298487, 23372434, 23407024, 23509357, 23557174, 23696797, 23742776, 24072746, 24099425, 24150233, 24185685, 24236052, 24256053, 24276590, 24326842, 24327474, 24351116, 24374826, 24564183, 24596383, 24614362, 24632608, 24655000, 24670538, 24755270, 24811362, 24870795, 25050737, 25176506, 25189759, 25205654, 25308734, 25320004, 25326806, 25337226, 25351816, 25379015, 25542236, 25562781, 25573380, 25613482, 25627005, 25730079, 25738807, 25788424, 25811800, 25833691, 25835177, 25921632, 25941985, 25961845, 25979438, 26004948, 26139991, 26197083, 26202395, 26261088, 26293643, 26328748, 26446946, 26497667, 26596835, 26601990, 26663949, 26716898, 26915610, 26916087, 26923392, 27039800, 27115178, 27154576, 27184932, 27280700, 27384731, 27406386, 27456862, 27515134, 27569079, 27602581, 27621042, 27651160, 27861153, 27919191, 28004430, 28071891, 28098359, 28202627, 28215146, 28296543, 28419967, 28423526, 28423685, 28454256, 28459196, 28605336, 28633995, 28707555, 28711021, 28800785, 28819116, 28830617, 28844759, 28893556, 28927692, 28980922, 29021381, 29042458, 29089666, 29104509, 29113219, 29115580, 29151916, 29212256, 29254314, 29259250, 29260433, 29288085, 29338907, 29342940, 29369806, 29420334, 29422250, 29432944, 29482009, 29492204, 29520667, 29536537, 29578150, 29578156, 29609579, 29617556, 29687772, 29721201, 29725473, 29774068, 29854811, 29861845, 29878766, 29969438, 29989060, 30008898, 30021014, 30046339, 30052166, 30183516, 30209062, 30214563, 30226596, 30249503, 30253391, 30274515, 30281903, 30286327, 30333314, 30339905, 30358613, 30383677, 30458325, 30497805, 30500835, 30509240, 30548095, 30581847, 30595215, 30655800, 30660006, 30710501, 30779087, 30849160, 30993496, 31009737, 31011867, 31143300, 31202170, 31266364, 31293975, 31381135, 31404330, 31444237, 31492006, 31502574, 31526394, 31563120, 31611756, 31624248, 31637006, 31677179, 31683461, 31777578, 31820313, 31839881, 7635566, 7669564, 8014015, 8521611, 8561867, 8570199, 8938149, 8968108, 9389934, 9643688, 9918199		★☆☆☆☆ Found in Text Mining only
Neoplasms, Intracranial	Intracranial Neoplasm	BEFREE	15122332, 23728345, 27757720		★☆☆☆☆ Found in Text Mining only
Nephrolithiasis	Nephrolithiasis	BEFREE	28205286, 28336462		★☆☆☆☆ Found in Text Mining only
Nephrolithiasis	Nephrolithiasis	Pubtator	28205286	Associate	★☆☆☆☆ Found in Text Mining only
Nephrolithiasis Calcium Oxalate	Nephrolithiasis	Pubtator	33345667	Associate	★☆☆☆☆ Found in Text Mining only
Nephrolithiasis Calcium Oxalate	Nephrolithiasis	Pubtator	37468493	Stimulate	★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	31012282, 31909567, 35620813	Associate	★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	27886560, 30123106		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10359016, 11228100, 12193473, 15833851, 17088992, 19540207, 19962414, 20971732, 23176145, 23317647, 25784559, 25889839, 28262117, 29241071, 30562971		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuroblastoma	Neuroblastoma	Pubtator	17088992, 19540207, 22507272, 23176145	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurocognitive Disorders	Neurocognitive Disorders	BEFREE	28487203		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	27589705, 30562971, 30986397	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	27181591, 30562971		★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	15255999, 34079083	Associate	★☆☆☆☆ Found in Text Mining only
Neuromuscular Diseases	Neuromuscular Diseases	LHGDN	16772717		★☆☆☆☆ Found in Text Mining only
Neuromyelitis Optica	Neuromyelitis Optica	BEFREE	26298319		★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	10408538, 29656686		★☆☆☆☆ Found in Text Mining only
NEUROTICISM	Neuroticism	BEFREE	31719821		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	28947666		★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	BEFREE	18846558, 19376817, 28933920, 31176670		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	29434690		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	15474669, 15949868, 16086239, 16513206, 17208328, 19132754, 19513513, 19596921, 19885594, 19933377, 20392988, 20709421, 21120482, 22204714, 22455335, 22465234, 23031673, 24264312, 24705809, 24789436, 24998555, 25095981, 25337249, 25345539, 25424698, 25659977, 25716201, 25746385, 26418253, 26429875, 27224551, 27470365, 27748898, 27938481, 28100078, 28202627, 28688608, 28704236, 28731781, 28945763, 29048613, 29207990, 29320940, 29344197, 29631554, 29783929, 29848704, 29897257, 30100736, 30214563, 30467633, 30564960, 30772141, 30889876, 31124298		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	CTD_human_DG	21789004		★☆☆☆☆ Found in Text Mining only
NONAKA MYOPATHY	Inclusion body myopathy	BEFREE	31077012		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	15469875, 21791204		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	16807982, 24099425, 24150233, 25320004		★☆☆☆☆ Found in Text Mining only
Norrie disease	Norrie Disease	BEFREE	11774399		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	15834245, 19466389, 22304569, 23804543, 27146834, 27825280, 28419983, 28771179, 30035656, 31464540		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	16034612, 23804543, 29737494	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	19466389, 20392866, 23975165, 27497609, 28419983, 37508583, 37671970	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	CTD_human_DG	21156398		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity Abdominal	Obesity	Pubtator	26097608	Associate	★☆☆☆☆ Found in Text Mining only
Ocular albinism, type II	Ocular albinism	BEFREE	28696822		★☆☆☆☆ Found in Text Mining only
Opitz GBBB Syndrome, X-Linked	Opitz GBBB Syndrome, X-Linked	BEFREE	29422250		★☆☆☆☆ Found in Text Mining only
Optic Neuritis	Optic Neuritis	BEFREE	26298319		★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral Submucous Fibrosis	CTD_human_DG	16311067		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Oral Submucous Fibrosis	Oral submucous fibrosis	Pubtator	17217211	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Oral Submucous Fibrosis	Oral Submucous Fibrosis	BEFREE	17617834, 21958210, 22309315		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	16309207	Associate	★☆☆☆☆ Found in Text Mining only
Osseous ankylosis	Osseous Ankylosis	BEFREE	31439411		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	14730609, 31042308	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	16806998, 17907186, 17975844, 22829602, 24067484, 24223987, 25430712, 26600476, 33540799, 33953899, 35734177, 38401067, 39176085	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Hip	Osteoarthritis	Pubtator	33540799, 38200556	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	26600476, 36216277	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis of hip	Osteoarthritis Of Hip	BEFREE	25151085		★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	LHGDN	17299841		★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	18802702		★☆☆☆☆ Found in Text Mining only
Osteogenesis Imperfecta Type IV	Osteogenesis imperfecta	Pubtator	28173836	Associate	★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglosphonic dysplasia	BEFREE	30317635		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	28062298, 28697211, 31032961, 31214897		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	26219353, 36451445	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	28466138, 29693149, 30186405, 31430857		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	LHGDN	12479099		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	18048360, 19020756, 19624845, 2169729, 22213073, 22292654, 22923031, 22948234, 23175213, 23527718, 23557174, 23661525, 23807047, 23900236, 24036215, 24190483, 25109282, 25177029, 25227664, 25427639, 25530132, 25728753, 25742474, 26130413, 26164004, 26239566, 26546437, 26707073, 26718453, 26979530, 27023472, 27562075, 27931795, 28315506, 28969043, 28983587, 29038881, 29068478, 29207109, 29905536, 30383677, 30840264, 31106479, 31262893		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	18048360, 19624845, 22213073, 22333159, 23322324, 23661525, 23886165, 24190483, 25177029, 25416443, 25855929, 26130413, 26546437, 26979530, 27023472, 27144433, 27562075, 28315506, 29048621, 30840264, 31302294, 32033398, 32312946, 34036868, 38538251, 39311783, 40676084	Associate	★☆☆☆☆ Found in Text Mining only
Otitis Media	Otitis media	BEFREE	31606684		★☆☆☆☆ Found in Text Mining only
Otitis Media with Effusion	Otitis media	LHGDN	16413616		★☆☆☆☆ Found in Text Mining only
Otitis Media with Effusion	Otitis media	BEFREE	31606684		★☆☆☆☆ Found in Text Mining only
Ovarian Cysts	Ovarian Cysts	BEFREE	16213873		★☆☆☆☆ Found in Text Mining only
Ovarian Cysts	Ovarian cysts	Pubtator	22495744	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	34247803	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	25482733		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	10995877, 15623631, 17475671, 18559505, 22471482, 22579115, 22832979, 23580092, 25738807, 26168135, 28859117, 29461589, 9743290		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	14500349, 15384859, 16469801, 17475671		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	11355948, 15557756, 16080542, 16124061, 17475671, 18559505, 18980978, 20124444, 20564628, 20649989, 21151448, 21676452, 22471482, 22495744, 22652451, 23340649, 23824740, 24408020, 25277199, 26298390, 26526575, 27712592, 27737724, 27888810, 28401704, 28859117, 29693178, 29758922, 30469078, 31129149, 32706063, 32718331, 33763485, 35621926, 35953860, 37644468	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	20334653, 28627617, 28868628	Stimulate	★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	16166639, 17343740, 22917220, 25794856		★☆☆☆☆ Found in Text Mining only
Pain Insensitivity Congenital	Congenital pain insensitivity	Pubtator	26283785	Associate	★☆☆☆☆ Found in Text Mining only
Panacinar Emphysema	Panacinar emphysema	CTD_human_DG	25106431		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	12167581, 12947332, 15257104, 16340751, 16510599, 18397859, 18410405, 19670328, 19908231, 20571492, 21283078, 22159401, 25883224, 26866436, 27459514, 29687228, 30941918, 30958531, 31061236, 7635566		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	30941918		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	11854622, 12947332, 15239215, 18030366, 18410405		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	CTD_human_DG	22952646		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	11882904, 17378244, 18410405, 19670328, 20354770, 22957785, 23270819, 23300530, 23538603, 23920124, 23992308, 24008827, 24336522, 25111230, 25217324, 25883224, 26652622, 28368050, 28393239, 29687228, 31061236, 31161784, 32809114, 32812320, 33098056, 34114996, 35599471	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	18706098, 25274283	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatitis	Pancreatitis	Pubtator	18706098	Associate	★☆☆☆☆ Found in Text Mining only
Papillary Meningioma	Papillary Meningioma	BEFREE	22995327		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	18310287, 22049175, 22253131, 24276590, 24670538, 27250077, 28731152, 28751724, 28848996, 29632659, 30497805, 30509240, 30675296, 31211500		★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	16357172		★☆☆☆☆ Found in Text Mining only
Paracoccidioidomycosis	Paracoccidioidomycosis	Pubtator	25204704	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	19962414, 24040066, 26844501, 26938614, 31493243		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	24040066, 26844501, 26938614, 37270490	Associate	★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	27190383		★☆☆☆☆ Found in Text Mining only
Parotitis	Parotitis	LHGDN	17237723		★☆☆☆☆ Found in Text Mining only
Paroxysmal atrial fibrillation	Paroxysmal atrial fibrillation	BEFREE	31242971		★☆☆☆☆ Found in Text Mining only
Paroxysmal ventricular fibrillation	Paroxysmal ventricular fibrillation	Pubtator	23557756	Associate	★☆☆☆☆ Found in Text Mining only
Pediatric Obesity	Childhood obesity	BEFREE	21844877, 28810559		★☆☆☆☆ Found in Text Mining only
PEELING SKIN SYNDROME	Peeling Skin Syndrome	BEFREE	31440939		★☆☆☆☆ Found in Text Mining only
Pelvic Inflammatory Disease	Pelvic inflammatory disease	Pubtator	18937938	Stimulate	★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic Organ Prolapse	BEFREE	18274672, 22914468, 29073153		★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic organ prolapse	Pubtator	22914468, 28656271, 30939607, 34176919	Associate	★☆☆☆☆ Found in Text Mining only
Pemphigoid Bullous	Bullous pemphigoid	Pubtator	11710917, 16291395, 31440247, 36685490	Associate	★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	LHGDN	17311292		★☆☆☆☆ Found in Text Mining only
Pemphigus Vulgaris	Pemphigus Vulgaris	BEFREE	17311292		★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic ulcer disease	Pubtator	34188075	Associate	★☆☆☆☆ Found in Text Mining only
Periapical Periodontitis	Periapical periodontitis	Pubtator	18926740	Associate	★☆☆☆☆ Found in Text Mining only
Periapical Periodontitis	Periapical Periodontitis	BEFREE	30681895		★☆☆☆☆ Found in Text Mining only
Pericardial effusion	Pericardial effusion	BEFREE	31419595		★☆☆☆☆ Found in Text Mining only
Pericementitis	Pericementitis	CTD_human_DG	22808498, 24640096		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal disease	Pubtator	25155252, 25826490, 26743292, 29610270, 35363329	Associate	★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	27587368, 28427461, 29610270, 31214897		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	15107580, 17448043, 23252412, 23653009, 27095260, 27194818, 28043014, 28351517, 29129647, 29315565, 29972696, 30246792, 30348440, 30444938, 31032961, 31355267, 31560804, 31680280		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Periodontitis	Periodontitis	CTD_human_DG	22808498, 24640096		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Periodontitis	Periodontitis	Pubtator	25607396, 29072221, 32130362, 35451104, 39266981, 40281482	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Periodontitis	Periodontitis	Pubtator	26821679	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	30773823		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	29558999, 30471427		★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	LHGDN	12471459		★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	29558999, 30471427		★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Vascular Diseases	BEFREE	14681642, 24369095		★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Peripheral vascular disease	Pubtator	14681642	Associate	★☆☆☆☆ Found in Text Mining only
Peritoneal Fibrosis	Peritoneal Fibrosis	BEFREE	27190383		★☆☆☆☆ Found in Text Mining only
Peritoneal Neoplasms	Peritoneal neoplasm	Pubtator	32472047	Associate	★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	21089052	Stimulate	★☆☆☆☆ Found in Text Mining only
Peyronie Disease	Peyronie Disease	BEFREE	15302515, 31650486		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	29654109		★☆☆☆☆ Found in Text Mining only
Phyllodes Tumor	Phyllodes Tumor	BEFREE	27909812		★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	BEFREE	27594586		★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	18552985, 27860331, 28391660, 28964682, 29110608, 29853773		★☆☆☆☆ Found in Text Mining only
Pilocytic Astrocytoma	Astrocytoma	CTD_human_DG	20188714		★☆☆☆☆ Found in Text Mining only
Pituitary Adenoma	Pituitary adenoma	BEFREE	17200207, 28194042, 28500926, 30458325, 30676069		★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	16167532, 17200207, 26286316, 26681056, 28194042, 28288092	Associate	★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary Neoplasms	LHGDN	17200207		★☆☆☆☆ Found in Text Mining only
Platelet alpha-Granule Deficiency	Platelet Alpha-Granule Deficiency	BEFREE	29930006		★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	BEFREE	15824527		★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	LHGDN	15824527		★☆☆☆☆ Found in Text Mining only
PNEUMOTHORAX, PRIMARY SPONTANEOUS	Pneumothorax	BEFREE	25300296, 28088269, 30033106		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	LHGDN	16338908		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	28300464, 28598286, 30969784, 30989649		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	28300464, 40287692	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	35551681	Inhibit	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	39796177	Stimulate	★☆☆☆☆ Found in Text Mining only
Polycythemia	Polycythemia	Pubtator	25906101	Associate	★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	25684469, 25906101		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	25684469, 25906101	Associate	★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	BEFREE	11157561, 27374114		★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	LHGDN	16097959		★☆☆☆☆ Found in Text Mining only
POPLITEAL PTERYGIUM SYNDROME, LETHAL TYPE	Bartsocas-Papas syndrome	BEFREE	24065177		★☆☆☆☆ Found in Text Mining only
Posterior subcapsular cataract	Capsular cataract	BEFREE	22259225		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	LHGDN	18829111		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	28719899		★☆☆☆☆ Found in Text Mining only
Premature aging syndrome	Premature aging	BEFREE	18554282		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	14550924, 30412498		★☆☆☆☆ Found in Text Mining only
Primary angle-closure glaucoma	Angle closure glaucoma	BEFREE	17110919, 18552608, 19633731, 21655354, 23441116, 26854036, 27272641, 29432439		★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	23809662		★☆☆☆☆ Found in Text Mining only
Prolactinoma	Prolactinoma	BEFREE	26071077, 27310993		★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	18552985, 27860331, 28391660, 28627654, 28964682, 29853773		★☆☆☆☆ Found in Text Mining only
Prostate cancer familial	Prostate cancer	Pubtator	25724188, 31201369	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11477554, 12361907, 12586837, 12840218, 12894549, 14605668, 15048090, 15356679, 15922868, 16114056, 16619495, 16990429, 17175378, 17409440, 18337451, 18612129, 18615482, 19010864, 19303106, 20160036, 20207476, 20448670, 20550708, 21219645, 21306303, 21391788, 21828059, 22110740, 22200661, 22895549, 23526143, 23708657, 23792449, 24326842, 24360663, 24374826, 24390612, 24453046, 25056536, 25135278, 25310386, 26005860, 26564800, 27355218, 27931798, 28004109, 28237042, 28707808, 29107109, 29167276, 29175302, 29594945, 29650324, 30041429, 30249503, 30464622, 31381135, 31600936, 31660560, 9766654, 9950685		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Diseases	Prostatic Diseases	BEFREE	27931798		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic Hyperplasia	BEFREE	26564800		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	7506923	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasia	Prostatic intraepithelial neoplasia	Pubtator	16619495	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	16619495		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	11284727, 18167127, 18337451, 18615482, 19147749, 19330806, 19582779, 19895737, 20160036, 20550708, 20889560, 21545229, 22074556, 22139647, 22272343, 22642976, 23476138, 24151226, 24386413, 24390612, 24413182, 24589892, 25056536, 25623427, 25871394, 25967040, 26097550, 26115086, 26312765, 26337460, 26564800, 26742965, 27357608, 28278500, 29300772, 30134822, 31241916, 31600936, 32692888, 33569050, 34085788, 36361790, 37834295, 39297880, 9950685	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	12372334, 15356679, 16114056, 17175378, 18167127, 18618693, 18852494, 19010864		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	16606632		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	21391788, 23673480, 27355218, 28178391		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Protoplasmic astrocytoma	Protoplasmic Astrocytoma	CTD_human_DG	20188714		★☆☆☆☆ Found in Text Mining only
Pseudoxanthoma Elasticum	Pseudoxanthoma elasticum	BEFREE	19575173		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	11380613, 29979898		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	34122426, 36293148, 38115636	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	34691360	Stimulate	★☆☆☆☆ Found in Text Mining only
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	26554609		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	19536654		★☆☆☆☆ Found in Text Mining only
Pterygium	Pterygium	BEFREE	19420332, 30591791, 31691974		★☆☆☆☆ Found in Text Mining only
Ptosis	Ptosis	BEFREE	22914468		★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	18355767	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	21063214		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	14624669, 14676438, 17136983, 17579045, 18046864, 20075389, 21429222, 23606791, 23900981, 24993912, 25635861, 26439471, 27035424, 27313452, 27880043, 28537664, 28949773, 29403273, 30133616, 30429371, 30643813, 30781876, 31679431, 33198738, 34820703, 37654522, 38387446	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	18229576, 21483784, 23148928, 24176116, 25332229, 25849664, 26126526, 28202627, 33070147, 34210319, 37123074	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	11254539, 11708786, 11875051, 12383023, 15714064, 16126934, 23161884, 23734748, 24039251, 24043489, 28254114, 28704475, 29268377, 30542429, 30781876, 30993494		★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	LHGDN	16921111		★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	CTD_human_DG	25106431		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	17702637, 20392358, 23161884, 27866296, 28254114, 29216763, 29417309, 30257362, 30653976, 30666825		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary Fibrosis	CTD_human_DG	21468558		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	28254114	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pyelonephritis	Pyelonephritis	LHGDN	12612199		★☆☆☆☆ Found in Text Mining only
Pyoderma Gangrenosum	Pyoderma gangrenosum	Pubtator	20636397	Associate	★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	19419554, 29578156		★☆☆☆☆ Found in Text Mining only
Recurrent aphthous ulcer	Aphthous Ulcer	BEFREE	24118356		★☆☆☆☆ Found in Text Mining only
Recurrent depressive disorder	Mental Depression	BEFREE	27434116		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	16466849, 16596214, 17541305, 21808237, 23281640, 23969530, 24714873, 24870795, 25588050, 26732239, 28107702, 29103203, 29190630, 30224058, 30338828, 31053527, 31258725		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	17572184		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	27566305, 27760767, 28709131, 28885334, 31132220, 31773705		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	16509766, 30509751, 30564523, 31642817		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	28962107, 29253353, 29670537, 30308440, 31060326, 31311916, 31531373		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Newborn	Congenital alveolar dysplasia	BEFREE	20335295		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	22825827, 33982786	Associate	★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal detachment	Pubtator	12000736	Associate	★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	21933988, 31100326		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	CTD_human_DG	23075401		★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	29742163, 30591791		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	23077401, 29243776	Associate	★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	23383271, 25647033, 29744877, 31311559		★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy of prematurity	Pubtator	28103583	Stimulate	★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	29312345		★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy of prematurity	Pubtator	37894989	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	23900236, 24190483		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	24190483	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatic Heart Disease	Rheumatic Heart Disease	BEFREE	16406300		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10531073, 11669152, 12379519, 16507143, 17426140, 17697361, 18567920, 19446344, 19765281, 22614743, 22960198, 23058179, 23146660, 23696630, 23861949, 25000305, 26130073, 26436849, 27495116, 28573370, 28901438, 29287749, 29706965, 30100905, 30242542, 30397034, 30668267, 31012109, 31234900, 31322192, 31430907		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	18050191		★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	16106101	Associate	★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	16900772	Stimulate	★☆☆☆☆ Found in Text Mining only
Rickets	Rickets	BEFREE	29991364		★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	27569079	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoglycanopathies	Sarcoglycanopathy	BEFREE	28821434		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	19847138, 21959615	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	21959615		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	17077165, 17487380, 24378964		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	LHGDN	17077165		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	17077165, 23661254, 23900236, 24085323, 24190483, 25436070	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	12847101, 36988561, 39234629	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	23661254, 24085323	Associate	★☆☆☆☆ Found in Text Mining only
Sarcopenia	Sarcopenia	Pubtator	39519004	Associate	★☆☆☆☆ Found in Text Mining only
Schinzel-Giedion syndrome	Schinzel-Giedion Syndrome	BEFREE	24574426		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	19264454, 19536654, 20197064, 20510460, 21437990, 25837304, 25933951, 28100419, 28623238, 29448178, 30619470, 30668668, 31094241, 31464540, 31555105		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	19264454, 20510460		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	20161799	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scleroderma Systemic	Systemic sclerosis	Pubtator	15642145, 32807242	Stimulate	★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	24982919, 28002595	Associate	★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	16551873		★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	27124018	Associate	★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	39612636	Stimulate	★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	35184762	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Septicemia	Septicemia	BEFREE	11529928, 24833564, 29861795		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	CTD_human_DG	16003065		★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	29970365		★☆☆☆☆ Found in Text Mining only
Sex Differentiation Disorders	Sex Differentiation Disorders	BEFREE	28118356		★☆☆☆☆ Found in Text Mining only
Shprintzen-Goldberg syndrome	Shprintzen-Goldberg Syndrome	BEFREE	24574426		★☆☆☆☆ Found in Text Mining only
Sicca Syndrome	Sjogren`s Syndrome	BEFREE	30707337		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sjogren's Syndrome	Sjogren syndrome	Pubtator	11145040	Stimulate	★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	12115190, 16142742, 31010136, 36008454	Associate	★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	15642145, 16291395, 19865095, 21777517, 39465738	Associate	★☆☆☆☆ Found in Text Mining only
Skin Erosion	Skin Erosion	BEFREE	30029761		★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	14551878, 17403874		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	LHGDN	18042068		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Skin Neoplasms	Skin Neoplasms	CTD_human_DG	18572023		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sleep Apnea Obstructive	Sleep apnea	Pubtator	25753939, 32711518, 34239024	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	23792205, 25753939, 26169999, 29693002, 29729418, 30928393		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Small cell carcinoma of lung	Lung carcinoma	BEFREE	24755270, 26050228		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	24755270, 26050228, 26823791	Associate	★☆☆☆☆ Found in Text Mining only
SPHEROCYTOSIS, TYPE 1 (disorder)	Spherocytosis	BEFREE	30903721		★☆☆☆☆ Found in Text Mining only
Spinal Cord Diseases	Spinal Cord Diseases	LHGDN	15465610		★☆☆☆☆ Found in Text Mining only
Spinal Cord Neoplasms	Spinal Cord Neoplasms	BEFREE	29113175, 30570882		★☆☆☆☆ Found in Text Mining only
Spinal stenosis of lumbar region	Spinal Stenosis Of Lumbar Region	BEFREE	30067795		★☆☆☆☆ Found in Text Mining only
Splenic Hypoplasia	Splenic Hypoplasia	BEFREE	25441669		★☆☆☆☆ Found in Text Mining only
Spondylarthritis	Spondyloarthritis	BEFREE	31672632		★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	36700196, 38019769	Associate	★☆☆☆☆ Found in Text Mining only
Spondylo-ocular syndrome	Spondyloocular Syndrome	BEFREE	29774103		★☆☆☆☆ Found in Text Mining only
Spontaneous pneumothorax	Spontaneous pneumothorax	BEFREE	28088269, 30033106		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	11326313, 14694517, 15229899, 17208328, 17617834, 18062964, 18234959, 18302674, 19008210, 19064570, 19122290, 19541433, 19619798, 21174909, 22292754, 22466894, 22924547, 24466237, 26261088, 27161218, 28160595, 28521433, 29134466, 29876004, 31510782		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	11920505, 12029498, 12479097, 15033492, 15254682, 17310847, 17617834, 17922642, 18302674, 18680431, 19093256		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	CTD_human_DG	18572023		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	15333466, 15682484, 18680431, 22433565, 24351116, 24789592, 25391977, 25428380, 25966235, 26190820, 27057634, 27689325, 28152502, 28423526, 28652766, 29306013, 29693138, 31824776		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	12404284, 16097450, 16309207, 18234959, 18254958, 18853752, 20237901, 21174909, 21205837, 22410369, 22466894, 23107277, 24344026, 24466237, 24715175, 24716969, 25268950, 25432135, 26036622, 26151845, 26159854, 26434905, 26515287, 26666815, 26745629, 26874697, 27021541, 28626969, 30396177, 30657561, 31143300, 31263828, 31366234, 31759370, 31799662, 32471980, 32961679, 33237244, 33420101, 33498448, 34041883, 34636197, 35951144, 36674806, 37116157, 38030062	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	31510782, 37640804	Stimulate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	26050228, 7961122		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of oropharynx	Oropharyngeal carcinoma	BEFREE	11920505		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	29904102, 30247783		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	11078794, 11920505, 12404284, 15363550, 16515711, 18457660, 20851953, 21380786, 21958210, 22309315, 23122824, 23349315, 24332981, 24379084, 24798676, 28521433, 30396177, 31366234		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	22466894, 25001480, 25268950, 27280700, 29134466		★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	24695986, 29141241, 29274308, 31764795		★☆☆☆☆ Found in Text Mining only
Stable angina	Stable Angina	BEFREE	12205736, 18035073, 24709882, 26122234, 29211854		★☆☆☆☆ Found in Text Mining only
Stable angina	Stable Angina	CTD_human_DG	20981132		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	27124018		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	21791204		★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	10971173, 17077165		★☆☆☆☆ Found in Text Mining only
Stevens-Johnson Syndrome	Stevens-Johnson Syndrome	LHGDN	15449075		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	15565457, 16237750, 17465457, 17486447, 17617834, 18451255, 20066900, 20333791, 20360147, 20514448, 20559690, 21089052, 21337552, 24185685, 25174603, 25207654, 25253129, 25301736, 25394504, 25398131, 25586465, 25613482, 25627005, 25633484, 25724188, 26156886, 26259977, 26291058, 26362716, 26625734, 27053167, 27154576, 28060752, 28235803, 28459196, 28534934, 29030742, 29228747, 29651326, 29963765, 30192003, 30544870, 30570882, 30815034, 31026069, 31202170, 31632572, 31681401, 31816819		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	12443715, 12452001, 15565457, 17486447, 18283635, 18451255		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	12717827, 15161022, 15565457, 15929167, 15929172, 16124061, 16237750, 17094486, 17465457, 18296264, 18468407, 19294533, 19371443, 19586554, 19924065, 20164037, 20187983, 20333791, 20491781, 20950454, 21047770, 21089052, 21134074, 21777278, 22112973, 22289522, 22677901, 22821546, 23383271, 23402362, 23638161, 24175775, 24905806, 25120745, 25207654, 25253129, 25627005, 25724188, 25790118, 25875631, 25921630, 26291058, 26652716, 27076771, 27154576, 28060752, 28404958, 28459196, 28534934, 28621235, 28944890, 29808160, 29963765, 30453504, 30570882, 30821221, 31127138, 31556767, 31766266, 32866138, 33054752, 33069758, 33110200, 33773545, 34034702, 34078310, 34885656, 35431500, 35563563, 35566048, 35848483, 36580668, 37565919, 37573302, 37653798, 9681807	Associate	★☆☆☆☆ Found in Text Mining only
Strawberry nevus of skin	Strawberry Nevus Of Skin	BEFREE	30070315		★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	22395947, 25932641, 26330106, 29763368, 30158363, 31012282, 31564697, 31909567, 32626985	Associate	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	23555845, 27633189, 27796945, 27844284, 27979493, 28373092, 28460607, 29296615, 29434735, 29763368, 29801873, 29855971, 29880550, 30018671, 30738334, 30910643		★☆☆☆☆ Found in Text Mining only
Subependymal Giant Cell Astrocytoma	Astrocytoma	CTD_human_DG	20188714		★☆☆☆☆ Found in Text Mining only
Subfertility	Subfertility	BEFREE	11404367		★☆☆☆☆ Found in Text Mining only
SVEINSSON CHORIORETINAL ATROPHY	Sveinsson Chorioretinal Atrophy	BEFREE	27546031		★☆☆☆☆ Found in Text Mining only
Sweet Syndrome	Sweet syndrome	Pubtator	20636397, 21658319	Associate	★☆☆☆☆ Found in Text Mining only
Sweet Syndrome	Sweet Syndrome	BEFREE	30707337		★☆☆☆☆ Found in Text Mining only
Symmetric Diabetic Proximal Motor Neuropathy	Symmetric Diabetic Proximal Motor Neuropathy	CTD_human_DG	20213226		★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	23661254, 30707337		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	14749977		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	Pubtator	35292262	Associate	★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	12007723, 20110530, 21455563, 28002595, 30536805, 31440939		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Systemic Scleroderma	Scleroderma	LHGDN	15642145, 17493602		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Takayasu Arteritis	Takayasu Arteritis	LHGDN	12952836		★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	11555602, 27577949		★☆☆☆☆ Found in Text Mining only
Temporomandibular Joint Disorders	Temporomandibular Joint Disorders	BEFREE	26244436		★☆☆☆☆ Found in Text Mining only
Tendinopathy	Tendinopathy	BEFREE	19148938		★☆☆☆☆ Found in Text Mining only
Teratoma	Teratoma	BEFREE	31778275		★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular neoplasm	Pubtator	30924599	Associate	★☆☆☆☆ Found in Text Mining only
Tetralogy of Fallot	Tetralogy of Fallot	BEFREE	20541269, 30655554		★☆☆☆☆ Found in Text Mining only
Thoracic Diseases	Thoracic disease	Pubtator	16678588, 29291905, 33029260	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	37051288	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	25684469, 25906101		★☆☆☆☆ Found in Text Mining only
Thrombocytosis	Thrombocytosis	Pubtator	25906101	Associate	★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	16105066, 25906101, 27052781, 34348653, 40724896	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	22871832, 29521049		★☆☆☆☆ Found in Text Mining only
Thyroid cancer medullary	Medullary thyroid cancer	Pubtator	36156766	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	16203990, 20306451	Stimulate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	22253131, 24667444, 24670538, 24778099, 28731152, 28751724, 30272290, 30509240, 31378899, 32716342, 35275517, 36242015, 37671970	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	23150684, 26040765, 28715683, 30675296, 9545106		★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	29734379	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	BEFREE	22280229		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	17397984		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	23150684, 24670538, 28715683		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	23771538, 26040765, 28731152, 30069928, 32698816, 32716342, 35275517, 36906579, 37705974	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	29953504	Stimulate	★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue cancer	Pubtator	21174909, 27431199	Associate	★☆☆☆☆ Found in Text Mining only
Tonic - clonic seizures	Seizure	BEFREE	27886560		★☆☆☆☆ Found in Text Mining only
Total Hypotrichosis, Mari type	Hypotrichosis	BEFREE	24189491		★☆☆☆☆ Found in Text Mining only
Tourette Syndrome	Tourette syndrome	Pubtator	25772244	Stimulate	★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	BEFREE	27697435, 28893572		★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	11555602		★☆☆☆☆ Found in Text Mining only
Trigeminal Neuralgia	Trigeminal neuralgia	BEFREE	31009895		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	23263825, 25304315, 26537583, 27038254, 30241470, 32242230, 32332626, 32582965, 33352494, 34787047, 37511057, 37879215, 39294214, 39819723	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	24811362, 26125274, 27829549, 28927692, 30185799, 30241470, 30295647, 30368518, 30558648, 30848190		★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous sclerosis complex	Pubtator	36111504	Associate	★☆☆☆☆ Found in Text Mining only
Tubular Aggregate Myopathy	Tubular Aggregate Myopathy	BEFREE	27630207		★☆☆☆☆ Found in Text Mining only
Tumoral calcinosis	Tumoral Calcinosis	CTD_human_DG	15545515, 21193197		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	21678108, 23856509, 25961845, 27664275, 28079248, 28235803, 28391416, 28723856, 28854064, 28978100, 29767728, 30074183		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	CTD_human_DG	22119283		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uremia	Uremia	BEFREE	29891747		★☆☆☆☆ Found in Text Mining only
Uremia	Uremia	Pubtator	37867197	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	18630455, 18930813, 21695596, 22159600, 22695075, 22960341, 23271730, 24448324, 25099010, 25387487, 25884322, 26069102, 27440446, 27602581, 27631965, 29209142, 29237912, 29556633, 29578150, 30526300, 31894335, 33888644, 34329197, 34354794, 34565009, 35563650, 36444838, 36569935	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	23672427	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	21167264, 28651425		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	19079205	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	20109015, 24804816	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasm	Uterine cervix neoplasm	LHGDN	17671679		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	10486468, 15086734, 15989693, 16803520, 19906411, 20425121, 21219539, 22009750, 22438955, 23679328, 24481121, 24793016, 24804816, 25250801, 26191191, 26332389, 26526578, 26818472, 28259899, 29789601, 30484490, 31007650, 31026389, 31180057, 31638249, 32669083, 40603406	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	12189553	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	29610452	Inhibit	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	11371496, 27476775	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	34587931	Stimulate	★☆☆☆☆ Found in Text Mining only
Varicose Veins	Varicose veins	Pubtator	12844106, 28818228, 30558403, 32096196, 32594304	Associate	★☆☆☆☆ Found in Text Mining only
Varicose Veins	Varicose veins	Pubtator	18971037	Stimulate	★☆☆☆☆ Found in Text Mining only
Varicosity	Vulval varices	LHGDN	12704537		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Varicosity	Vulval varices	BEFREE	21195432, 24785109, 26130791, 30558403, 31738197		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vascular Diseases	Vascular Diseases	BEFREE	12975253, 14681642, 17617834, 18173548, 28245103		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	14681642, 20534943, 28300464	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Remodeling	Vascular remodeling	Pubtator	30133616, 35372112	Associate	★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	32164582, 38357816	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	11529928, 25004843		★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	17898039	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis Leukocytoclastic Cutaneous	Vasculitis	Pubtator	32461624	Stimulate	★☆☆☆☆ Found in Text Mining only
Vasculitis of large artery	Vasculitis	BEFREE	29970365		★☆☆☆☆ Found in Text Mining only
Vasospasm Intracranial	Intracranial vasospasm	Pubtator	23555845	Associate	★☆☆☆☆ Found in Text Mining only
Venous Insufficiency	Venous insufficiency	Pubtator	11700497	Associate	★☆☆☆☆ Found in Text Mining only
Venous Thrombosis	Venous thrombosis	Pubtator	32156832, 40724896	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular arrhythmia	Ventricular arrhythmia	BEFREE	30784925		★☆☆☆☆ Found in Text Mining only
Ventricular Dysfunction	Ventricular dysfunction	Pubtator	33579197	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Dysfunction Left	Ventricular dysfunction	Pubtator	19808299	Stimulate	★☆☆☆☆ Found in Text Mining only
Ventricular Dysfunction Left	Ventricular dysfunction	Pubtator	33579197	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Ventricular remodeling	Pubtator	16202218, 20707992, 21817815, 23807291, 23856618, 27126693, 33198738, 33579197	Associate	★☆☆☆☆ Found in Text Mining only
Vertebrobasilar Dolichoectasia	Vertebrobasilar Dolichoectasia	BEFREE	31474817		★☆☆☆☆ Found in Text Mining only
Vertical Talus	Vertical Talus	BEFREE	29981290		★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin D Deficiency	BEFREE	29991364, 31061278		★☆☆☆☆ Found in Text Mining only
Wieacker syndrome	Wieacker syndrome	Pubtator	27070589	Associate	★☆☆☆☆ Found in Text Mining only