MMP1 (matrix metallopeptidase 1)

Gene

• Entrez ID: 4312
• Gene name: Matrix metallopeptidase 1
• Gene symbol: MMP1
• Synonyms (NCBI Gene): CLG, CLGN
• Chromosome: 11
• Chromosome location: 11q22.2
• Summary: This gene encodes a member of the peptidase M10 family of matrix metalloproteinases (MMPs). Proteins in this family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and t

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT000136	hsa-miR-222-3p	Flow, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	19487542
MIRT006062	hsa-miR-203a-3p	ELISA, qRT-PCR	21279994
MIRT006062	hsa-miR-203a-3p	ELISA, qRT-PCR	21279994
MIRT006062	hsa-miR-203a-3p	ELISA, qRT-PCR	21279994
MIRT006062	hsa-miR-203a-3p	ELISA, qRT-PCR	21279994
MIRT006062	hsa-miR-203a-3p	ELISA, qRT-PCR	21279994
MIRT006062	hsa-miR-203a-3p	ELISA, qRT-PCR	21279994
MIRT021518	hsa-miR-145-5p	Reporter assay;Microarray	21351259
MIRT731775	hsa-miR-526b-3p	Luciferase reporter assay, qRT-PCR, Western blot	26292968
MIRT731775	hsa-miR-526b-3p	Luciferase reporter assay, qRT-PCR, Western blot	26292968
MIRT735068	hsa-miR-27a-5p	Luciferase reporter assay, Western blotting, Microarray, Immunofluorescence, qRT-PCR, Flow cytometry	32790210
MIRT735328	hsa-miR-100-5p	Microarray, qRT-PCR, ELISA	32299427
MIRT2273238	hsa-miR-4774-3p	CLIP-seq
MIRT2438634	hsa-miR-1228	CLIP-seq
MIRT2438635	hsa-miR-1238	CLIP-seq
MIRT2438636	hsa-miR-1976	CLIP-seq
MIRT2438637	hsa-miR-2116	CLIP-seq
MIRT2438638	hsa-miR-3120-5p	CLIP-seq
MIRT2438639	hsa-miR-3140-3p	CLIP-seq
MIRT2438640	hsa-miR-3160-3p	CLIP-seq
MIRT2438641	hsa-miR-3671	CLIP-seq
MIRT2438642	hsa-miR-431	CLIP-seq
MIRT2438643	hsa-miR-4421	CLIP-seq
MIRT2438644	hsa-miR-4432	CLIP-seq
MIRT2438645	hsa-miR-4487	CLIP-seq
MIRT2438646	hsa-miR-4652-3p	CLIP-seq
MIRT2438647	hsa-miR-4677-5p	CLIP-seq
MIRT2438648	hsa-miR-4691-5p	CLIP-seq
MIRT2438649	hsa-miR-4753-3p	CLIP-seq
MIRT2438650	hsa-miR-526b	CLIP-seq
MIRT2438651	hsa-miR-548u	CLIP-seq
MIRT2438652	hsa-miR-558	CLIP-seq
MIRT2438653	hsa-miR-587	CLIP-seq
MIRT2438654	hsa-miR-593	CLIP-seq
MIRT2438655	hsa-miR-607	CLIP-seq
MIRT2571980	hsa-let-7a	CLIP-seq
MIRT2571981	hsa-let-7b	CLIP-seq
MIRT2571982	hsa-let-7c	CLIP-seq
MIRT2571983	hsa-let-7d	CLIP-seq
MIRT2571984	hsa-let-7e	CLIP-seq
MIRT2571985	hsa-let-7f	CLIP-seq
MIRT2571986	hsa-let-7g	CLIP-seq
MIRT2571987	hsa-let-7i	CLIP-seq
MIRT2438635	hsa-miR-1238	CLIP-seq
MIRT2571988	hsa-miR-1248	CLIP-seq
MIRT2571989	hsa-miR-127-5p	CLIP-seq
MIRT2571990	hsa-miR-1299	CLIP-seq
MIRT2571991	hsa-miR-153	CLIP-seq
MIRT2571992	hsa-miR-190	CLIP-seq
MIRT2571993	hsa-miR-190b	CLIP-seq
MIRT2438636	hsa-miR-1976	CLIP-seq
MIRT2571994	hsa-miR-202	CLIP-seq
MIRT2438637	hsa-miR-2116	CLIP-seq
MIRT2438638	hsa-miR-3120-5p	CLIP-seq
MIRT2571995	hsa-miR-3121-3p	CLIP-seq
MIRT2438639	hsa-miR-3140-3p	CLIP-seq
MIRT2571996	hsa-miR-3148	CLIP-seq
MIRT2571997	hsa-miR-3156-5p	CLIP-seq
MIRT2438640	hsa-miR-3160-3p	CLIP-seq
MIRT2571998	hsa-miR-3176	CLIP-seq
MIRT2571999	hsa-miR-3192	CLIP-seq
MIRT2572000	hsa-miR-3201	CLIP-seq
MIRT2572001	hsa-miR-326	CLIP-seq
MIRT2572002	hsa-miR-330-5p	CLIP-seq
MIRT2572003	hsa-miR-3664-5p	CLIP-seq
MIRT2572004	hsa-miR-3922-3p	CLIP-seq
MIRT2572005	hsa-miR-4277	CLIP-seq
MIRT2572006	hsa-miR-4307	CLIP-seq
MIRT2438642	hsa-miR-431	CLIP-seq
MIRT2572007	hsa-miR-4314	CLIP-seq
MIRT2572008	hsa-miR-4420	CLIP-seq
MIRT2438643	hsa-miR-4421	CLIP-seq
MIRT2438644	hsa-miR-4432	CLIP-seq
MIRT2572009	hsa-miR-4458	CLIP-seq
MIRT2572010	hsa-miR-448	CLIP-seq
MIRT2438645	hsa-miR-4487	CLIP-seq
MIRT2572011	hsa-miR-4500	CLIP-seq
MIRT2572012	hsa-miR-450b-3p	CLIP-seq
MIRT2572013	hsa-miR-450b-5p	CLIP-seq
MIRT2572014	hsa-miR-4635	CLIP-seq
MIRT2572015	hsa-miR-4646-5p	CLIP-seq
MIRT2438646	hsa-miR-4652-3p	CLIP-seq
MIRT2438647	hsa-miR-4677-5p	CLIP-seq
MIRT2438648	hsa-miR-4691-5p	CLIP-seq
MIRT2572016	hsa-miR-4713-3p	CLIP-seq
MIRT2572017	hsa-miR-4714-5p	CLIP-seq
MIRT2438649	hsa-miR-4753-3p	CLIP-seq
MIRT2572018	hsa-miR-4791	CLIP-seq
MIRT2572019	hsa-miR-488	CLIP-seq
MIRT2438650	hsa-miR-526b	CLIP-seq
MIRT2572020	hsa-miR-539	CLIP-seq
MIRT2438651	hsa-miR-548u	CLIP-seq
MIRT2438652	hsa-miR-558	CLIP-seq
MIRT2572021	hsa-miR-570	CLIP-seq
MIRT2438654	hsa-miR-593	CLIP-seq
MIRT2572022	hsa-miR-638	CLIP-seq
MIRT2572023	hsa-miR-668	CLIP-seq
MIRT2572024	hsa-miR-759	CLIP-seq
MIRT2572025	hsa-miR-769-3p	CLIP-seq
MIRT2572026	hsa-miR-873	CLIP-seq
MIRT2572027	hsa-miR-875-3p	CLIP-seq
MIRT2572028	hsa-miR-891b	CLIP-seq
MIRT2572029	hsa-miR-9	CLIP-seq
MIRT2572030	hsa-miR-98	CLIP-seq
MIRT2571980	hsa-let-7a	CLIP-seq
MIRT2571981	hsa-let-7b	CLIP-seq
MIRT2571982	hsa-let-7c	CLIP-seq
MIRT2571983	hsa-let-7d	CLIP-seq
MIRT2571984	hsa-let-7e	CLIP-seq
MIRT2571985	hsa-let-7f	CLIP-seq
MIRT2571986	hsa-let-7g	CLIP-seq
MIRT2571987	hsa-let-7i	CLIP-seq
MIRT2438635	hsa-miR-1238	CLIP-seq
MIRT2571989	hsa-miR-127-5p	CLIP-seq
MIRT2571992	hsa-miR-190	CLIP-seq
MIRT2571993	hsa-miR-190b	CLIP-seq
MIRT2438636	hsa-miR-1976	CLIP-seq
MIRT2571994	hsa-miR-202	CLIP-seq
MIRT2438637	hsa-miR-2116	CLIP-seq
MIRT2438638	hsa-miR-3120-5p	CLIP-seq
MIRT2438639	hsa-miR-3140-3p	CLIP-seq
MIRT2438640	hsa-miR-3160-3p	CLIP-seq
MIRT2571999	hsa-miR-3192	CLIP-seq
MIRT2572000	hsa-miR-3201	CLIP-seq
MIRT2572001	hsa-miR-326	CLIP-seq
MIRT2572002	hsa-miR-330-5p	CLIP-seq
MIRT2572006	hsa-miR-4307	CLIP-seq
MIRT2438642	hsa-miR-431	CLIP-seq
MIRT2572007	hsa-miR-4314	CLIP-seq
MIRT2572008	hsa-miR-4420	CLIP-seq
MIRT2438643	hsa-miR-4421	CLIP-seq
MIRT2438644	hsa-miR-4432	CLIP-seq
MIRT2572009	hsa-miR-4458	CLIP-seq
MIRT2438645	hsa-miR-4487	CLIP-seq
MIRT2572011	hsa-miR-4500	CLIP-seq
MIRT2572012	hsa-miR-450b-3p	CLIP-seq
MIRT2572014	hsa-miR-4635	CLIP-seq
MIRT2572015	hsa-miR-4646-5p	CLIP-seq
MIRT2438646	hsa-miR-4652-3p	CLIP-seq
MIRT2438647	hsa-miR-4677-5p	CLIP-seq
MIRT2438648	hsa-miR-4691-5p	CLIP-seq
MIRT2572016	hsa-miR-4713-3p	CLIP-seq
MIRT2438649	hsa-miR-4753-3p	CLIP-seq
MIRT2572018	hsa-miR-4791	CLIP-seq
MIRT2572019	hsa-miR-488	CLIP-seq
MIRT2438650	hsa-miR-526b	CLIP-seq
MIRT2438651	hsa-miR-548u	CLIP-seq
MIRT2438652	hsa-miR-558	CLIP-seq
MIRT2438654	hsa-miR-593	CLIP-seq
MIRT2572022	hsa-miR-638	CLIP-seq
MIRT2572023	hsa-miR-668	CLIP-seq
MIRT2572025	hsa-miR-769-3p	CLIP-seq
MIRT2572030	hsa-miR-98	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
BACH1	Activation	21873975
CEBPB	Unknown	19723873
CITED2	Repression	12960175
ETS1	Activation	15972796;16278291;17283078
ETS1	Unknown	10949659;11556732;21244711
ETS2	Unknown	21244711
ETV3	Unknown	10913304
ETV4	Unknown	9794472
FLI1	Repression	15972796
FOS	Activation	19028685
FOS	Unknown	9334186
FOSL1	Unknown	18802113
GATA3	Unknown	21244711
JUN	Activation	19028685;19708869;20225236
JUN	Unknown	9334186
MAZ	Activation	19028685
NFKB1	Activation	16278291;16385502
NFKB1	Unknown	11376631;16210649
NFKBIA	Unknown	11376631
NR4A2	Repression	17283078
PAX5	Repression	22105368
PPARG	Unknown	15090544
RELA	Activation	16278291;16385502
RELA	Unknown	11376631;16210649
RFWD2	Repression	12615916
STAT3	Unknown	16205632;17460772;21410405
TP53	Repression	15108353
TWIST1	Unknown	23222305
ZNF410	Unknown	12370286

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004175	Function	Endopeptidase activity	IDA	19022250
GO:0004175	Function	Endopeptidase activity	IEA
GO:0004222	Function	Metalloendopeptidase activity	IBA
GO:0004222	Function	Metalloendopeptidase activity	IDA	9920899
GO:0004222	Function	Metalloendopeptidase activity	IEA
GO:0004222	Function	Metalloendopeptidase activity	TAS	3027129
GO:0004252	Function	Serine-type endopeptidase activity	TAS
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0006508	Process	Proteolysis	IDA	15863497, 19022250
GO:0006508	Process	Proteolysis	IEA
GO:0006508	Process	Proteolysis	TAS	2167156
GO:0008233	Function	Peptidase activity	IDA	23845380
GO:0008233	Function	Peptidase activity	IEA
GO:0008237	Function	Metallopeptidase activity	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008270	Function	Zinc ion binding	TAS	2167156
GO:0016787	Function	Hydrolase activity	IEA
GO:0022617	Process	Extracellular matrix disassembly	TAS
GO:0030198	Process	Extracellular matrix organization	IBA
GO:0030574	Process	Collagen catabolic process	IBA
GO:0030574	Process	Collagen catabolic process	IEA
GO:0030574	Process	Collagen catabolic process	TAS
GO:0031012	Component	Extracellular matrix	IEA
GO:0031334	Process	Positive regulation of protein-containing complex assembly	IDA	19022250
GO:0046872	Function	Metal ion binding	IEA
GO:0071492	Process	Cellular response to UV-A	IDA	31380578

Other IDs

• MIM: 120353
• HGNC: 7155
• e!Ensembl: ENSG00000196611

Protein

• UniProt ID: P03956
• Protein name: Interstitial collagenase (EC 3.4.24.7) (Fibroblast collagenase) (Matrix metalloproteinase-1) (MMP-1) [Cleaved into: 22 kDa interstitial collagenase; 27 kDa interstitial collagenase]
• Protein function: Cleaves collagens of types I, II, and III at one site in the helical domain. Also cleaves collagens of types VII and X (PubMed:1645757, PubMed:2153297, PubMed:2557822). In case of HIV infection, interacts and cleaves the secreted viral Tat prote
• PDB: 1AYK, 1CGE, 1CGF, 1CGL, 1HFC, 1SU3, 2AYK, 2CLT, 2J0T, 2TCL, 3AYK, 3SHI, 4AUO, 4AYK, 966C
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01471	PG_binding_1	27 → 87	Putative peptidoglycan binding domain	Domain
  PF00413	Peptidase_M10	108 → 261	Matrixin	Domain
  PF00045	Hemopexin	284 → 326	Hemopexin	Repeat
  PF00045	Hemopexin	328 → 372	Hemopexin	Repeat
  PF00045	Hemopexin	377 → 424	Hemopexin	Repeat
  PF00045	Hemopexin	426 → 466	Hemopexin	Repeat

• Sequence:

  MHSFPPLLLLLFWGVVSHSFPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPV
  VEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIEN
  YTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGN
  LAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSY
  TFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDR
  FYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGY
  PKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFP
  GIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN

• Sequence length: 469

Pathways

KEGG:

PPAR signaling pathway
IL-17 signaling pathway
Relaxin signaling pathway
Coronavirus disease - COVID-19
Pathways in cancer
Bladder cancer
Rheumatoid arthritis
Lipid and atherosclerosis

Reactome:

Collagen degradation
Degradation of the extracellular matrix
Activation of Matrix Metalloproteinases
Basigin interactions
Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
Interleukin-4 and Interleukin-13 signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANEURYSM	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANGINA, UNSTABLE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTERIOSCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATHEROSCLEROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOSOMAL RECESSIVE GENERALIZED DYSTROPHIC EPIDERMOLYSIS BULLOSA, SEVERE FORM	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BARRETT ESOPHAGUS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, NON-SMALL-CELL LUNG	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY, DILATED	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CAROTID ARTERY DISEASES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CAROTID STENOSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL STENOSIS OF AORTIC VALVE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COPD, severe early onset	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPIDERMOLYSIS BULLOSA DYSTROPHICA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTROPHIC CARDIOMYOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Interstitial lung disease 2	Uncertain significance	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
KIDNEY FAILURE, CHRONIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG DISEASES, OBSTRUCTIVE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MMP1-related disorder	Likely benign; Benign; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONALCOHOLIC STEATOHEPATITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OCULAR HYPERTENSION	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ORAL SUBMUCOSAL FIBROSIS, INCLUDING OF TONGUE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ORAL SUBMUCOUS FIBROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Preterm premature rupture of membranes	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY OPEN ANGLE GLAUCOMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY DISEASE, CHRONIC OBSTRUCTIVE, RATE OF DECLINE OF LUNG FUNCTION IN	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Recessive dystrophic epidermolysis bullosa	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATIC AORTIC STENOSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VARICOSITY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
AA amyloidosis	AA amyloidosis	BEFREE	18815155		★☆☆☆☆ Found in Text Mining only
Actinic keratosis	Actinic keratosis	BEFREE	10362121		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	18480665, 23377317, 29044936		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	26050650		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	10430270, 15832405, 20584750, 20946664, 21143918, 7951846		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	15832405		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	19321798, 21143918, 31391080		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	29463039		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	12949792, 17089045, 19480010, 20437278, 8068180		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	LHGDN	17125518		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	11007031, 17125518		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	19728161		★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	11157561		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	11878827		★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	BEFREE	16302919		★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Alveolitis Extrinsic Allergic	Extrinsic allergic alveolitis	Pubtator	31590404	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	17660861	Inhibit	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	33892965	Associate	★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	BEFREE	20070483		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	23814055		★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	BEFREE	15671765		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	32009522	Associate	★☆☆☆☆ Found in Text Mining only
Aneurysm	Aneurysm	Pubtator	14612207	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aneurysm	Aneurysm	Pubtator	26443282, 29291905, 30497276, 34968687	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Angina Unstable	Angina pectoris	Pubtator	29044936	Associate	★☆☆☆☆ Found in Text Mining only
Angina, Unstable	Intermediate coronary syndrome	BEFREE	29044936		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Angle Closure Glaucoma	Angle Closure Glaucoma	BEFREE	23441116		★☆☆☆☆ Found in Text Mining only
Ankyloglossia	Ankyloglossia	HPO_DG			★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	22487523, 29896303		★☆☆☆☆ Found in Text Mining only
Anthracosis	Anthracosis	BEFREE	26528997		★☆☆☆☆ Found in Text Mining only
Anthracosis	Anterior uveitis	Pubtator	26528997	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	23603351		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	11877705	Stimulate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	27362269, 28209269, 29291905, 34968687	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Thoracic	Thoracic aortic aneurysm	Pubtator	29291905	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	15530910		★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	26305549		★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic valve disease	Pubtator	33029260	Associate	★☆☆☆☆ Found in Text Mining only
Arterial Occlusive Diseases	Arterial occlusive disease	Pubtator	14612207	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	11375412, 15034206, 19951575, 21742783, 23365489, 23800176, 28217098, 29622563, 9690907		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arthritis	Arthritis	BEFREE	10792621, 12010565, 12379519, 21801306, 28849139		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	21715326, 21801306, 26510114, 27052781, 30440036	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	26510114, 34963488	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	34305455	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10206959, 10531073, 10617637, 10693865, 11259586, 11840439, 11966774, 12379519, 14730602, 15142265, 16207318, 16385502, 16519794, 17009243, 17848581, 19627579, 19678938, 19883500, 22246057, 27534557, 28704431, 30046030, 30358109, 35126351, 35450396, 36439145, 37996918	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	35955467	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	15229943		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	14968124, 19191136, 24587395, 25180535, 27967204, 30450857, 31653934		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	LHGDN	19191136		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	19337515, 24587395, 26074138, 26851968, 38148093	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	CTD_human_DG	24469321		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	31653934	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	BEFREE	17502998, 27043542		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	27043542	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	11375412, 15034206, 19951575, 21742783, 23365489, 23800176, 28217098, 29622563, 9690907		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	Pubtator	11805151, 16580524, 16876267	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	LHGDN	16103692, 17316652		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	CTD_human_DG	21742783		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial Fibrillation	BEFREE	20935575		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrioventricular Block	Atrioventricular block	Pubtator	32555355	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	7671571		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	20079608		★☆☆☆☆ Found in Text Mining only
Autosomal recessive generalized dystrophic epidermolysis bullosa, severe form	Dystrophic Epidermolysis Bullosa	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	29201214		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	20584750, 20946664, 30670912		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Barrett Esophagus	Barrett esophagus	Pubtator	20946664, 30670912	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Basal Cell Nevus Syndrome	Basal cell nevus syndrome	Pubtator	19287498	Associate	★☆☆☆☆ Found in Text Mining only
Basal Cell Nevus Syndrome	Basal cell nevus syndrome	Pubtator	24369017	Stimulate	★☆☆☆☆ Found in Text Mining only
Bicuspid aortic valve	Bicuspid aortic valve	BEFREE	23603351		★☆☆☆☆ Found in Text Mining only
Bladder neck obstruction	Bladder neck obstruction	BEFREE	31316719		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	11396630, 17986285, 20826916, 23819551, 24635493, 25326231, 26197083, 26301605, 28013036		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	11705862, 17986285		★☆☆☆☆ Found in Text Mining only
Blister	Blister	Pubtator	7539470	Associate	★☆☆☆☆ Found in Text Mining only
Boerhaave syndrome	Boerhaave Syndrome	HPO_DG			★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	17363400, 23238945	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	17593251	Stimulate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	18588890		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	LHGDN	18588890		★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	33093584	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10854560, 14692651, 15149160, 15777790, 15841325, 15864312, 16267613, 16322260, 16430785, 16510585, 17663001, 17669621, 17695512, 18503039, 18597171, 18851945, 19584257, 20498646, 21642878, 22011282, 22296495, 22627808, 23217186, 23568046, 23696797, 24409301, 24596383, 24972610, 25022892, 25472536, 25527274, 25691572, 26513020, 27354592, 28334049, 28961241, 29132384, 29207651, 29633599, 29695550, 29870666, 30109192, 30127959, 30675232, 30733051, 31452777, 31537868, 31638975		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	23548910		★☆☆☆☆ Found in Text Mining only
Breast Diseases	Breast Diseases	BEFREE	22011282		★☆☆☆☆ Found in Text Mining only
Breast Diseases	Breast disease	Pubtator	22011282	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10889910, 15739263, 17695512, 18366705, 18503039, 19531263, 19661326, 20126581, 20412339, 21344163, 21834986, 22011282, 22627808, 23696797, 24409301, 24972610, 26513020, 27588391, 27857161, 28334049, 28961241, 30087366, 31292488, 31537868, 33371806, 33396463, 34313250, 34445715, 34636027, 35037689, 35466619, 36531485, 36800575, 8766524, 9888461	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	21835023, 23568046, 23762835	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	29695550	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchial Hyperreactivity	Bronchial Hyperreactivity	BEFREE	27967204		★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	BEFREE	19188843, 23776649		★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	Pubtator	23776649	Associate	★☆☆☆☆ Found in Text Mining only
Bronchitis	Bronchitis	Pubtator	34459757	Associate	★☆☆☆☆ Found in Text Mining only
Bursitis	Bursitis	BEFREE	15726092		★☆☆☆☆ Found in Text Mining only
Cakut	Congenital anomalies of kidney and urinary tract	BEFREE	24414606		★☆☆☆☆ Found in Text Mining only
Cancer of Nasopharynx	Nasopharyngeal Cancer	BEFREE	25891416		★☆☆☆☆ Found in Text Mining only
Cap Myopathy	Cap myopathy	Pubtator	16619495	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	17125518, 22086466, 31302419, 31537868, 32437034, 33888009	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10430270, 10874213, 10895017, 11007031, 11396630, 11812078, 12949792, 15103490, 15939478, 17663001, 19480010, 8068180, 9111003		★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	34171070	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	19916023	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	21665914, 21909684, 28387651, 28683186, 32951492, 35865652, 35948625, 36458010, 37309005, 40611075	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma in situ of uterine cervix	Cervical Intraepithelial Neoplasia	BEFREE	11812078		★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	20127359, 22011282, 26215578	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Merkel cell carcinoma	Pubtator	37207705	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	11396630, 17986285, 20826916, 23819551, 24635493, 25326231, 26197083, 26301605, 28013036		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	31275143		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	11691799, 15767330, 16311244, 17145822, 18483334, 19094243, 19507256, 19723873, 19963114, 20015200, 21523769, 22573325, 22965879, 22993337, 23313298, 26198673, 27659527, 29277780, 31244308		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	31731384, 35414794, 37821678	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	19551141, 37563650, 40386045	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	23139422	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	10362121, 12218298, 20874839, 24356192, 26515234, 33888009, 34301206, 34369270, 9649139	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	16214204, 17441888, 21093894, 25950130, 28262727		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	LHGDN	16681691		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	16095497	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	29250654	Inhibit	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	LHGDN	18028894		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	29250654		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathy, Dilated	Cardiomyopathy	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	16598395, 18028894, 27032379, 29250654		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	20031604, 20616161, 23497408, 28429955, 29407876		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	23497408	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	22683752, 7664418		★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	BEFREE	12364729		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carotid Stenosis	Carotid artery stenosis	Pubtator	26254334, 27017522, 30789935, 32101136	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carpal Tunnel Syndrome	Carpal Tunnel Syndrome	BEFREE	26521080		★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	14558091, 25263345, 26045200, 27245218, 30033738, 30551507, 40076528	Associate	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	HPO_DG			★☆☆☆☆ Found in Text Mining only
CATARACT, MARNER TYPE	Cataract	BEFREE	17940116		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	12229968, 15608660, 9862821		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	15608660	Stimulate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	34984852	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	15073384, 21232745, 31200003		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	21224082	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	21232745		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	14550952, 15617836, 17243165, 29436615		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervix carcinoma	Cervix carcinoma	BEFREE	14550952, 15617836, 17243165, 29436615		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	27798872, 28751566		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	15288468		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Cholangiocarcinoma	LHGDN	15288468		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chondrosarcoma	Chondrosarcoma	BEFREE	14554220, 15334640, 15499569, 15534109, 15927440, 16549373, 20102637, 26549320, 28035378, 29316907		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	14554220, 15927440, 20102637, 23892595, 24472657, 29316907	Associate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	LHGDN	15499569		★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	LHGDN	17949787		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	22401717		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	19406964, 19424605, 19578796		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	12383023, 20075389, 20160424, 20970515, 21245013, 21730072, 22993337, 23555986, 24039251, 24085258, 26439471, 27173221, 27412345, 30789935		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	LHGDN	16921115		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	HPO_DG			★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	12622858, 15257748, 16774538, 16899023, 18710412, 19040577, 19659894, 21481333, 21563948, 22401717, 22819245, 24134675, 27363729		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	LHGDN	12622858, 16774538, 18710412		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	22401717, 30945680	Associate	★☆☆☆☆ Found in Text Mining only
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	28771607, 30452122		★☆☆☆☆ Found in Text Mining only
Chronic sinusitis	Sinusitis	BEFREE	28398769		★☆☆☆☆ Found in Text Mining only
Chronic venous insufficiency	Venous Insufficiency	BEFREE	11700497		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	30336268, 9049202		★☆☆☆☆ Found in Text Mining only
Cockayne-Touraine Disease	Cockayne-Touraine Disease	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Colitis Collagenous	Collagenous colitis	Pubtator	10433942	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	10861266, 10940281	Stimulate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	12651627, 17009408, 17990358, 33299870	Associate	★☆☆☆☆ Found in Text Mining only
Colitis, Collagenous	Colitis	BEFREE	10433942, 21305678		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	11007031, 20702488, 21410405, 21531813, 22027145, 29357811, 30040915		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	32813775	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Polyps	Colonic polyps	Pubtator	28376625	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	11007031, 12432557, 12898592, 12949792, 15103490, 15701845, 16739355, 16937230, 17311017, 17339606, 17460772, 17608852, 18798060, 19507256, 19634113, 19843588, 20662554, 21410405, 21531813, 21538057, 23873107, 25594187, 26034135, 28376625, 30569725, 30654001, 30720073, 31001480		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	23548910		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	10794801, 16739355, 17311017, 22027145, 22363134, 25541970, 28687755, 29342159, 29973580, 32641980, 33893077, 34034060, 35456495, 36036380, 36789689	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	12432557, 12949792, 14707454, 15701845, 17125518, 17311017, 17543340, 18798060		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	23548910		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congestive heart failure	Congestive Heart Failure	BEFREE	12873541, 21300300, 30922470, 31844116		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conjunctivitis	Conjunctivitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Connective Tissue Diseases	Connective Tissue Disease	LHGDN	16453302		★☆☆☆☆ Found in Text Mining only
Contracture	Contracture	Pubtator	31467177	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	12845675, 15319295, 17980059, 18709334, 19551141, 26301605		★☆☆☆☆ Found in Text Mining only
Corneal Diseases	Corneal disease	Pubtator	19936308, 28631887	Associate	★☆☆☆☆ Found in Text Mining only
Corneal erosion	Corneal erosion	HPO_DG			★☆☆☆☆ Found in Text Mining only
Corneal Injuries	Corneal injury	Pubtator	31022731	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	14499230, 19006025, 21606841, 23377317, 25372932, 27323171, 27693213, 29622563, 31356534		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	BEFREE	14499230, 19006025, 21606841, 22226810, 23377317, 25372932, 27323171, 27693213, 29622563, 31356534		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	17893005	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	22388798, 27323171	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	14499230, 19006025, 21606841, 22226810, 23377317, 25372932, 27323171, 27693213, 29622563, 31356534		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Restenosis	Coronary restenosis	Pubtator	8774133	Associate	★☆☆☆☆ Found in Text Mining only
Craniocerebral Trauma	Craniocerebral trauma	Pubtator	26120586	Associate	★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	28398769, 31653934		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	10861266, 16954805, 17602907		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	10861266, 15804950	Stimulate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	12651627	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	LHGDN	15804950		★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	BEFREE	31295049		★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	11245423, 20655738, 22198560		★☆☆☆☆ Found in Text Mining only
Cutis Laxa	Cutis Laxa	BEFREE	9666818		★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	16213873		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	10628798, 23776649		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	19604728	Stimulate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	26485688	Associate	★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	BEFREE	30651780		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	10617637, 10914841, 11966774, 12379519, 12528113, 12632416, 12882354, 12913922, 14558091, 14730609, 16972994, 17966030, 18031579, 19998410, 21428299, 21770773, 22890185, 24635637, 25123228, 25496568, 25914226, 26404854, 26436377, 28173838, 28482921, 28968958, 29154876, 29245931, 29270923, 29949137, 30177524, 30261492, 30316071, 30464238, 30597276, 30886066, 8730110, 9365097, 9588741		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	LHGDN	12528113, 14558091, 17434489		★☆☆☆☆ Found in Text Mining only
Deglutition Disorders	Dysphagia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dental Enamel Hypoplasia	Dental Enamel Hypoplasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	17660861	Inhibit	★☆☆☆☆ Found in Text Mining only
Dermatitis Herpetiformis	Dermatitis herpetiformis	Pubtator	11247893, 7636299, 8980278	Associate	★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	11157561		★☆☆☆☆ Found in Text Mining only
Desmoid disease hereditary	Desmoid tumor	Pubtator	15054469	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	11696476, 12801609, 21563948		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	11696476, 12801609, 18097620, 21563948		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	22055260, 26988924, 29992758	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	27104752	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	17714581	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	27323171	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	26782559, 29395841		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	17714581, 19006025, 23337395, 27323171		★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic foot	Pubtator	35013299	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	29883760		★☆☆☆☆ Found in Text Mining only
Diverticular Diseases	Diverticular Diseases	BEFREE	11686522		★☆☆☆☆ Found in Text Mining only
Diverticular Diseases	Diverticular disease	Pubtator	24681094	Stimulate	★☆☆☆☆ Found in Text Mining only
Diverticulitis	Diverticulitis	BEFREE	11686522, 21438097		★☆☆☆☆ Found in Text Mining only
Dowling Degos Disease	Dowling degos disease	Pubtator	18439317	Associate	★☆☆☆☆ Found in Text Mining only
Dupuytren Contracture	Dupuytren contracture	Pubtator	17336841, 22987740, 23554969, 24293067	Associate	★☆☆☆☆ Found in Text Mining only
Dysplastic Nevus	Dysplastic Nevus	BEFREE	31677173		★☆☆☆☆ Found in Text Mining only
Dyssegmental dysplasia	Dyssegmental dysplasia	Pubtator	12568417	Associate	★☆☆☆☆ Found in Text Mining only
Dystrophia unguium	Nail dystrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Ectropion	Ectropion	HPO_DG			★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	16997735, 17363767, 18259971, 18617682, 19337515, 19605697, 23900981, 24792232, 27313452	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	10502722, 10874213, 11156241, 24820961		★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial Hyperplasia	BEFREE	22853432		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	10874213, 18644593, 22853432, 27898420	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	12034345, 15879464		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	15879464, 16210018, 16532917, 19345347, 19661147, 9240251		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	16210018, 19055724, 22024213, 32299427	Associate	★☆☆☆☆ Found in Text Mining only
Enteritis	Enteritis	BEFREE	15178550		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	9463570		★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa	Epidermolysis Bullosa	BEFREE	19197535		★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa Dystrophica	Dystrophic epidermolysis bullosa	Pubtator	12880418, 8143767	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epidermolysis Bullosa Dystrophica	Epidermolysis Bullosa	BEFREE	19681861		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epidermolysis Bullosa Dystrophica	Epidermolysis Bullosa	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epidermolysis Bullosa Dystrophica Inversa, Autosomal Recessive	Epidermolysis Bullosa Dystrophica Inversa	ORPHANET_DG			★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa Dystrophica, Autosomal Recessive, Localisata Variant	Epidermolysis Bullosa Dystrophica Inversa	ORPHANET_DG			★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa Pruriginosa	Epidermolysis Bullosa Pruriginosa	BEFREE	19197535		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	16214204, 17441888, 21093894		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	11058873, 11161388, 20946664		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	20946664		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	20946664	Stimulate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	26631031	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	11161388, 22086466, 27436512, 37635445, 39256753	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	20686364	Stimulate	★☆☆☆☆ Found in Text Mining only
Esophageal Stricture	Esophageal Stricture	HPO_DG			★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	12054564, 14550555, 23204234		★☆☆☆☆ Found in Text Mining only
Exfoliation Syndrome	Exfoliation Syndrome	BEFREE	20038976		★☆☆☆☆ Found in Text Mining only
Exudative age-related macular degeneration	Exudative Macular Degeneration	BEFREE	29947568		★☆☆☆☆ Found in Text Mining only
Familial cylindromatosis	Familial cylindromatosis	Pubtator	20946664	Associate	★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	22422400, 30670912		★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	33243243	Stimulate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	21664615		★☆☆☆☆ Found in Text Mining only
Fibrodysplasia Ossificans Progressiva	Fibrodysplasia Ossificans Progressiva	BEFREE	25773749		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	22853432		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	2157183, 22868188, 24038389		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	12557150, 14606082, 21382168, 23941979, 29512750, 30336268, 8608892		★☆☆☆☆ Found in Text Mining only
Follicular adenoma	Adenoma	BEFREE	16430475, 19480010		★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	19480010		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	21039987	Associate	★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	7951846		★☆☆☆☆ Found in Text Mining only
Gastroesophageal Reflux	Gastroesophageal reflux disease	Pubtator	22422400, 37907428	Associate	★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	BEFREE	22422400		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	24379393		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	24379393	Associate	★☆☆☆☆ Found in Text Mining only
Gingival Diseases	Gingival diseases	Pubtator	31743516	Associate	★☆☆☆☆ Found in Text Mining only
Gingival Hypertrophy	Gingival Hypertrophy	BEFREE	16945025		★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingivitis	BEFREE	27762733		★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingival diseases	Pubtator	30327948	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	20038976, 20089870, 27428613		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	20089870, 22615763, 26120586	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma Angle Closure	Angle closure glaucoma	Pubtator	18323704	Stimulate	★☆☆☆☆ Found in Text Mining only
Glaucoma Angle Closure	Angle closure glaucoma	Pubtator	23441116	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	18323704, 26120586	Stimulate	★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	20808730, 21709637, 23441116, 23800300	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma, Open-Angle	Glaucoma	BEFREE	20808730		★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	20808730, 21709637, 23441116, 23800300		★☆☆☆☆ Found in Text Mining only
Glaucoma, Suspect	Glaucoma	CTD_human_DG	20089869		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	15957163, 20706772, 21595984, 21858729, 31715381		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	21595984, 25825051	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	15957163, 20706772, 21595984, 21858729, 22162832, 25620587, 31715381		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	19489099, 30443853, 37335645	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	19629394, 20706772, 22162832		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	11014984, 8712219		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	Pubtator	22845765	Inhibit	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	35172688	Associate	★☆☆☆☆ Found in Text Mining only
Gout	Gout	Pubtator	36451451	Associate	★☆☆☆☆ Found in Text Mining only
Hallopeau-Siemens Disease	DYSTROPHIC EPIDERMOLYSIS BULLOSA	BEFREE	1353052, 18030675, 24899116		★☆☆☆☆ Found in Text Mining only
Hallopeau-Siemens Disease	DYSTROPHIC EPIDERMOLYSIS BULLOSA	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
Hallopeau-Siemens Disease	DYSTROPHIC EPIDERMOLYSIS BULLOSA	ORPHANET_DG			★☆☆☆☆ Found in Text Mining only
Hallopeau-Siemens Disease	DYSTROPHIC EPIDERMOLYSIS BULLOSA	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	16353148, 19843588, 23441173		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	12404284	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	21108787	Stimulate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	18617682	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	12873541, 21300300, 30922470, 31844116		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure	Heart failure	Pubtator	29784904	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure	Heart failure	Pubtator	31844116	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure Systolic	Heart failure	Pubtator	16814653	Stimulate	★☆☆☆☆ Found in Text Mining only
Hemangioblastoma	Hemangioblastoma	BEFREE	19551141		★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	BEFREE	10707367		★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	Pubtator	20661412	Associate	★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	Pubtator	9659170	Associate	★☆☆☆☆ Found in Text Mining only
HEMOCHROMATOSIS, TYPE 1	Hemochromatosis	BEFREE	29232935		★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	9240251	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	21835023	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	30679661	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	32050950	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	26215578	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary gingival fibromatosis	Hereditary Gingival Fibromatosis	BEFREE	10697802, 29989318		★☆☆☆☆ Found in Text Mining only
Hereditary Nonpolyposis Colorectal Cancer	Colorectal Cancer	BEFREE	12949792		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	18097620		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	Pubtator	29291905	Associate	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	Pubtator	35168639	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia, Familial	Hypercholesterolemia	BEFREE	15662225		★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type IIa	Hyperlipoproteinemia	BEFREE	15662225		★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	20614262	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	16814653	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	17901377, 18097620, 23116893		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoalbuminemia	Hypoalbuminemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	17099219, 19661326, 20102637, 25217834, 25861162, 27245780, 28426715	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	23965235	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	24927122	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	21793800		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	LHGDN	18447576, 18853190		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	18853190, 26121236		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	33046043, 33672678, 33905434, 36221131, 36998092, 37907428	Associate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	24927122	Associate	★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	11817610		★☆☆☆☆ Found in Text Mining only
Inclusion Body Myositis (disorder)	Inclusion Body Myositis	BEFREE	11157561		★☆☆☆☆ Found in Text Mining only
Infarction, Middle Cerebral Artery	Cerebral Infraction	BEFREE	31319804		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	10861266, 17206679, 19137636, 24378596		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	10861266, 19137636, 36647141	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	LHGDN	12651627		★☆☆☆☆ Found in Text Mining only
Inflammatory Breast Carcinoma	Breast Cancer	BEFREE	17669621		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	23370084, 26782559, 27706715, 30458287		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	25640554, 26505388, 27706715, 28497435, 31408735, 32829335, 36817437	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	26782559	Stimulate	★☆☆☆☆ Found in Text Mining only
Intervertebral disc disease	Intervertebral disc disease	Pubtator	18439317, 25640554, 27706715, 31408735	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral disc disorder	Intervertebral Disc Disorder	BEFREE	26782559		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Displacement	Intervertebral disc displacement	Pubtator	32556014, 39933558	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	29680481		★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	27418197		★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	20946664		★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	27032379		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	24771042, 24834994, 27793533, 28958661, 29906531		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	26510114		★☆☆☆☆ Found in Text Mining only
Kashin-Beck Disease	Kashin-Beck Disease	BEFREE	27245218		★☆☆☆☆ Found in Text Mining only
Keratitis	Keratitis	Pubtator	28573109	Associate	★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	21031023	Stimulate	★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	22413749, 27207902, 36051483	Associate	★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	BEFREE	28393195		★☆☆☆☆ Found in Text Mining only
Keratocystic Odontogenic Tumor	Keratocystic Odontogenic Tumor	BEFREE	16183790		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	22401717	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	22401717		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Neoplasms	Kidney neoplasm	Pubtator	17980059	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	32636440	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	12739032, 16265652, 26323359, 31275143		★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	22853432, 23814095	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	27798872		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	30747385		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	15475433, 17352267, 18712673, 27381606, 30117779		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12063553, 15027120, 15467742, 20969862, 21665914, 28387651, 30168096, 9049202		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	15818737, 17564313, 18426080		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	12760742, 30336268, 9049202		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	14606082, 16474379, 35035671, 35715541	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	33737203	Inhibit	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	14730602, 15142265	Associate	★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	8129038	Associate	★☆☆☆☆ Found in Text Mining only
Localized scleroderma	Scleroderma	LHGDN	18565735		★☆☆☆☆ Found in Text Mining only
Lumbar disc disease	Lumbar Disc Disease	BEFREE	18439317		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	LHGDN	18447576		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	19337515, 22992722, 25599395, 27245780	Associate	★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	25497407		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	32396269	Stimulate	★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	28002595, 33446609	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	28002595		★☆☆☆☆ Found in Text Mining only
Lung Diseases, Obstructive	Lung Diseases	BEFREE	21948273		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	1457364, 19643940, 19723873, 21523769, 22993337, 25149157, 27232698, 27659527, 9877171	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	LHGDN	15375490, 16311244, 16767672, 18483334		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	23548910		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	BEFREE	24727000, 27226640, 9877171		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	26198673	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	31156624	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	19951575		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	30973283	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphangioleiomyomatosis	Lymphangiomyomatosis	BEFREE	15111304		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	15528217, 15832405, 19634113		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	LHGDN	15754326		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	18507028, 20946664, 22086466, 24505369, 33819484, 33893077	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	28122331, 29436615, 35456495	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	1645604		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	18954439	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	28751566		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	28751566		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	15957163, 19629394		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	16353148, 19843588, 23441173		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	14692651, 15149160, 15864312, 16267613, 16322260, 16430785, 16510585, 17663001, 17669621, 17695512, 18503039, 18597171, 18851945, 19584257, 20498646, 21642878, 22011282, 22296495, 22627808, 23217186, 23568046, 23696797, 24409301, 24596383, 24972610, 25022892, 25472536, 25527274, 25691572, 26513020, 27354592, 28334049, 28961241, 29132384, 29207651, 29633599, 29695550, 29870666, 30109192, 30127959, 30675232, 30733051, 31452777, 31537868, 31638975		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	23548910		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	24820961		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	20946664		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	23644699, 7951846		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	17980059, 19843588		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	31275143		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11691799, 15767330, 16311244, 17145822, 18483334, 19094243, 19507256, 19963114, 20015200, 21523769, 22573325, 22965879, 22993337, 23313298, 26198673, 27659527, 29277780, 31244308		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	23548910		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	15475433, 17352267, 18712673, 27381606, 30117779		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of nasopharynx	Nasopharyngeal carcinoma	BEFREE	25891416		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	10485461, 16214204, 21093894, 25950130, 28262727		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	17876328, 19885545, 31115512, 7635566		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	12664060, 16619495, 18025848, 19303106, 19639194, 19782069, 25115393, 29970511, 30133758, 30464622		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	29570674, 8297480		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	14986114, 16707434, 21761103, 21966428, 22057037, 22469989, 22655095, 23705892, 23893803, 24505369, 25148204, 25253367, 9197533		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	29048269, 8685037		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of tongue	Malignant Neoplasm Of Tongue	BEFREE	18276095		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	11396630, 17986285, 20826916, 23819551, 24635493, 25326231, 26197083, 26301605, 28013036		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10485461, 10842101, 11396630, 11528521, 11691799, 12622858, 14550952, 14986114, 15475433, 15617836, 15688379, 15701845, 15767330, 15864312, 15939478, 16302919, 16774538, 16937230, 17352267, 18025848, 18276095, 18469853, 19489686, 19639194, 19661340, 19800199, 19843588, 19923455, 20015200, 20855151, 21154774, 21523769, 21642878, 21665914, 21948155, 22011282, 22573325, 23644699, 23687338, 24972610, 25391421, 25497407, 25725450, 25959126, 26510914, 27381606, 28482915, 29695550, 29970511, 30283446, 30594980, 30627228, 30628094, 30670912, 30905819, 31461579, 31715381, 7951846, 9049202, 9463570, 9918220		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	14550952, 15617836, 17243165, 29436615		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	21531813, 22027145, 29357811, 30040915		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	HPO_DG			★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	23548910		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	14692651, 15149160, 16168111, 16267613, 17663001, 17669621, 18366705		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	16322260, 16430785, 19622769, 22011282, 22809510, 9014756		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	23548910		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	23548910		★☆☆☆☆ Found in Text Mining only
Maternal hypertension	Maternal hypertension	BEFREE	28626073		★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	10688373		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	10415749, 10688373, 11156241, 11159206, 11802203, 11875642, 15184373, 15982688, 17339606, 20655738, 21642878, 2167156, 22198560, 22573325, 23222305, 25117819, 31677173, 9194570		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	11159206, 11997078, 14519134, 15009703, 15184373, 16829852, 22198560, 23222305, 27007357, 33980846, 38527983, 9194570	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	LHGDN	14962105, 15737206, 17625450, 18006830		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	21119930	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma Cutaneous Malignant	Melanoma	Pubtator	20655738, 22198560	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	23238945		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	25269045	Associate	★☆☆☆☆ Found in Text Mining only
MERRF Syndrome	MERRF Syndrome	BEFREE	15965045, 20411357		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	11027427, 20661412	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	12612292	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	25211325, 27219887		★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	16033831		★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	29845254		★☆☆☆☆ Found in Text Mining only
Microstomia	Microstomia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Miller Dieker syndrome	Miller Dieker Syndrome	BEFREE	28262842		★☆☆☆☆ Found in Text Mining only
Mitochondrial Encephalomyopathies	Mitochondrial encephalomyopathy	BEFREE	15965045		★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	16210018, 32461624, 9240251	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	17594482	Stimulate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	17352267, 22297602, 36510962	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	10620064, 17593251, 26545722, 9269785	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	LHGDN	18472160		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	11437495, 12020967, 19628284, 30619040		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	19902258		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	28262842		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	28262842	Inhibit	★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE DISORDER, CHRONIC, WITH EOSINOPHILIA	Myeloproliferative Disorder with Eosinophilia	BEFREE	29997916		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	11216828, 16210545, 35912721	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	BEFREE	14659851, 15476622, 16210545, 19620856, 19797822, 21300300, 28101856, 28429955, 30244779		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	LHGDN	16767840, 18298349		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial ischemia	Pubtator	35912721	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocarditis	Myocarditis	Pubtator	36226312	Associate	★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	BEFREE	19279308, 23077567		★☆☆☆☆ Found in Text Mining only
Myotonia Fluctuans (disorder)	Myotonia Fluctuans	BEFREE	26707272		★☆☆☆☆ Found in Text Mining only
NAIL DISORDER, NONSYNDROMIC CONGENITAL, 9	Nail Diseases	HPO_DG			★☆☆☆☆ Found in Text Mining only
Nail dysplasia	Nail dysplasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	11768703, 28398769, 28771607		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	25390332, 28398769	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	12517806, 15688379, 16912175, 17599818, 17913445, 25312481, 25481674, 25891416, 27354591, 28672814, 29096757, 31302419		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	28672814, 31302419, 34293937, 34544905	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	33564686	Stimulate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Neoplasms	Nasopharyngeal carcinoma	Pubtator	37915157	Associate	★☆☆☆☆ Found in Text Mining only
Neck Neoplasms	Neck Neoplasms	BEFREE	9463570		★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	22511625	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10362121, 10485461, 10874213, 11007031, 11020242, 11156241, 11159206, 11168802, 11299727, 11396630, 11489811, 11494026, 11875642, 11997078, 12949792, 14554220, 15140235, 15334640, 15499569, 15661214, 15809710, 15832405, 16158950, 16214204, 16267613, 16322260, 16455304, 1645604, 16596214, 17460772, 17663001, 17695512, 17876328, 17980449, 17986285, 18006807, 18503039, 18597171, 19465902, 19584257, 19610062, 19835631, 20064377, 20437278, 21093894, 21424117, 2167156, 21761103, 21858729, 22105368, 22198560, 22363134, 22853432, 23001823, 23217186, 23687338, 23696795, 23696797, 23846687, 24356192, 24379393, 24727000, 24972610, 25022892, 25117819, 25326231, 26631031, 27130665, 28122331, 28604765, 28637905, 29042458, 29321953, 29623449, 29896303, 30037277, 30157947, 30468076, 30591440, 30675232, 31275143, 31341031, 31350707, 31646745, 8362969, 9463570, 9683296		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	27604189	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	30385861		★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	16619545	Associate	★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	17599818		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	CTD_human_DG	21664615		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	15528217, 20471133, 22993337, 29207990, 31670855		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	CTD_human_DG	20471133		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	21664615		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	CTD_human_DG	21664615		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	26215578		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	19585142, 23497408, 29317790		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	21952248, 23497408	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	29784904	Inhibit	★☆☆☆☆ Found in Text Mining only
Ocular Hypertension	Ocular Hypertension	CTD_human_DG	20089869		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ocular Hypertension	Ocular hypertension	Pubtator	20089870	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	28604765		★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral Submucous Fibrosis	CTD_human_DG	16311067		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Oral Submucous Fibrosis	Oral Submucous Fibrosis	BEFREE	20860530, 21341274		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Oral Submucous Fibrosis	Oral submucous fibrosis	Pubtator	20930336	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Orofacial Cleft 1	Orofacial cleft	Pubtator	21052871	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	11966774, 14730609, 20517696, 23965235	Inhibit	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	12379519, 12882354, 14558091, 14697681, 15743480, 16806998, 21194467, 23809184, 24225084, 25501175, 29863238, 30177524, 30563239, 32095874, 34078001, 34547432	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	25432384, 30597276, 35955467	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	24838892, 30177524, 33903094	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis of hip	Osteoarthritis Of Hip	BEFREE	16972994		★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	18802702, 24838892, 30177524		★☆☆☆☆ Found in Text Mining only
Osteogenesis Imperfecta	Osteogenesis imperfecta	Pubtator	37021796	Associate	★☆☆☆☆ Found in Text Mining only
Osteomyelitis	Osteomyelitis	BEFREE	19821768, 29049163		★☆☆☆☆ Found in Text Mining only
Osteomyelitis	Osteomyelitis	Pubtator	19821768, 29049163	Associate	★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	31389576, 7796353		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	31389576	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	21640141, 30594980, 30977909, 8892967		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	21640141	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Cysts	Ovarian Cysts	BEFREE	16213873		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	16214204, 25950130, 28262727, 29970559		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	22652451, 9240251	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	10430270, 17876328, 19885545, 31115512, 7635566		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	10430270		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	10362099, 22160930, 23608755, 25483099, 34114996, 35414794	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	27435927	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	23608755	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	23608755	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	23644943, 8017097		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	31646745		★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	9463570		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	15337261		★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	15337261		★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic organ prolapse	Pubtator	20102291, 23108733, 28849117, 31116709	Associate	★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic Organ Prolapse	BEFREE	22210296, 23108733, 24202438, 31116709		★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic organ prolapse	Pubtator	34036402	Stimulate	★☆☆☆☆ Found in Text Mining only
Penile Neoplasms	Penile neoplasm	Pubtator	28122331	Associate	★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	15312099, 23500593		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	15312099, 16899023, 18166107, 19040577, 19659894, 21732946, 23500593, 23527212, 23653009, 26988924, 27194818, 28682139, 30355945, 31444694, 8774491		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	25861162, 26988924, 31444694	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	34968687	Associate	★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	18507028	Associate	★☆☆☆☆ Found in Text Mining only
Polyarthritis	Polyarthritis	BEFREE	26510114		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	27418197		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	15866608		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	15866608	Associate	★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	BEFREE	11157561		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	26137961		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	26050650		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	20861920, 31124581		★☆☆☆☆ Found in Text Mining only
Primary amyloidosis	Amyloidosis	BEFREE	16164636		★☆☆☆☆ Found in Text Mining only
Primary angle-closure glaucoma	Angle closure glaucoma	BEFREE	23441116		★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	15288468		★☆☆☆☆ Found in Text Mining only
Progressive pseudorheumatoid dysplasia	Progressive Pseudorheumatoid Dysplasia	BEFREE	17483925		★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	27860331		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	12664060, 16619495, 18025848, 19303106, 19639194, 19782069, 25115393, 29970511, 30133758, 30464622		★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasia	Prostatic intraepithelial neoplasia	Pubtator	16619495	Inhibit	★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	16619495		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	18025848, 18360703, 18852494		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	19610059, 26337460, 29845254, 32669958, 36524848	Associate	★☆☆☆☆ Found in Text Mining only
Pterygium	Pterygium	BEFREE	11146729, 14578390, 16049334		★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	21793800		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	19337515, 20075389, 21245013, 22739086, 22993337, 24792232, 27313452, 28949773, 36221131	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	30789935	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	11254539, 11875051, 12652812, 12676763, 1458541, 17363767, 21730072, 23900981, 24039251, 25497407, 9230755		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	20392358, 23776649		★☆☆☆☆ Found in Text Mining only
Reactive systemic amyloidosis	Reactive Systemic Amyloidosis	BEFREE	18815155		★☆☆☆☆ Found in Text Mining only
Rectal Prolapse	Rectal Prolapse	BEFREE	30221334		★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	17980059, 19843588		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	12845675, 15319295, 17980059		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	15319295, 17980059, 18709334, 19551141, 26301605		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	29465592		★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	21245013		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory Tract Diseases	BEFREE	21245013		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory system infectious disease	Pubtator	21245013	Associate	★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	14730602		★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy of prematurity	Pubtator	37894989	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatic Heart Disease	Rheumatic Heart Disease	BEFREE	29458338		★☆☆☆☆ Found in Text Mining only
Rheumatic Heart Disease	Rheumatic heart disease	Pubtator	29458338	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10531073, 10617637, 10914841, 11528521, 11817610, 11824952, 11840439, 11966774, 12009332, 12379519, 12517948, 12571844, 12632416, 12687542, 12913922, 1411083, 14626631, 14730602, 15142265, 15229943, 16519794, 17697361, 19056796, 19296301, 19379726, 19504098, 19678938, 19800199, 20079608, 20887233, 21279994, 21753786, 21770773, 22246057, 23223421, 24254222, 24764451, 26404854, 27653023, 27733582, 28032317, 28165872, 28463788, 28550307, 28577436, 28704431, 28849139, 29093715, 29394098, 29706965, 29848388, 30358109, 30562482, 31002160, 8730110		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	12784383, 14730602		★☆☆☆☆ Found in Text Mining only
Rotator cuff syndrome	Rotator cuff syndrome	BEFREE	28160256, 31652448		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	15127970		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	LHGDN	12054564		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Sarcoma	BEFREE	18006807		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Sarcoma	Pubtator	21801306	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma Ewing	Sarcoma	Pubtator	14550555	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	12542540, 15675950, 16301681, 16977444, 24630239, 28884475		★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	13130479, 23041765, 24289089, 28002595	Associate	★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	29342159		★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	16397242		★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	17363400	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	21591259, 24833564, 29861795		★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	25527274		★☆☆☆☆ Found in Text Mining only
Severe myopia	Myopia	BEFREE	20435584		★☆☆☆☆ Found in Text Mining only
Severe periodontitis	Periodontitis	BEFREE	23500593		★☆☆☆☆ Found in Text Mining only
Skin Erosion	Skin Erosion	BEFREE	27653023, 9365097		★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	13130479		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	23792205		★☆☆☆☆ Found in Text Mining only
Sleep Disorders Circadian Rhythm	Sleep disorder	Pubtator	21835023	Associate	★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	18678577	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	10362121, 11168802, 11235994, 12739032, 1323216, 15475433, 15661214, 16256416, 17352267, 17919326, 20946664, 21960692, 24278120, 29249121, 30226546, 31084699, 31525531		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	15200479, 15274394, 15832405, 17919326		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	15069682, 15832405, 25391977, 27130665, 29290801, 29605445		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	12404284, 1323216, 15274394, 17352267, 17919326, 18254958, 19487542, 19835631, 20614262, 21694466, 21960692, 22580338, 24278120, 24321173, 27797381, 28637905, 30226546, 30431092, 32015424, 32623386, 34445087, 34445346, 35426219, 35655921, 35756415, 36510962, 37185487, 37705232	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	22809838, 32437034	Stimulate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of oropharynx	Oropharyngeal carcinoma	BEFREE	31525531		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	1323216, 15194213, 15274394, 20860530, 22809838, 24063540, 28637905		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	18276095, 19487542		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	21664615		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	14986114, 21761103, 21966428, 22057037, 22469989, 22655095, 23705892, 23893803, 24505369, 25148204, 25253367, 9197533		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	14986114		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	16707434, 18468407, 18507028, 20563765, 22655095, 22677901, 23847441, 24260584, 24505369, 24927122, 25253367, 31151932, 32866138, 33437215, 37957566, 9197533	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	24505369		★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	32009522	Stimulate	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	11546917		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	Pubtator	39390512	Associate	★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	11528521, 12542540, 12692352, 15675950, 16301681, 16410344, 16977444, 20653770, 22890162, 23041765, 23223421, 24289089, 24630239, 28002595, 28068631, 28884475, 30157947, 30536805, 9373715		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	LHGDN	12692352, 18323784, 18506448		★☆☆☆☆ Found in Text Mining only
Tendinopathy	Tendinopathy	BEFREE	23389922, 24995609, 28091588, 29532899		★☆☆☆☆ Found in Text Mining only
Thoracic Diseases	Thoracic disease	Pubtator	29291905, 33029260	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocytosis	Thrombocytosis	Pubtator	29420626	Associate	★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	Pubtator	17352267	Associate	★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	12393408	Associate	★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	12643848		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	29048269, 8685037, 9349574		★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	27796151	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	BEFREE	19480010		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	29048269, 8685037		★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue cancer	Pubtator	19138406	Associate	★☆☆☆☆ Found in Text Mining only
Tourette Syndrome	Tourette syndrome	Pubtator	25772244	Stimulate	★☆☆☆☆ Found in Text Mining only
Transient Cerebral Ischemia	Cerebral Ischemia	BEFREE	15073384		★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	BEFREE	15073384		★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	17296440		★☆☆☆☆ Found in Text Mining only
Trichiasis	Trichiasis	BEFREE	20237245		★☆☆☆☆ Found in Text Mining only
Trichothiodystrophy Syndromes	Trichothiodystrophy	BEFREE	25605938		★☆☆☆☆ Found in Text Mining only
Trichothiodystrophy Syndromes	Trichothiodystrophy	Pubtator	25605938	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	21835023	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	28604765		★☆☆☆☆ Found in Text Mining only
Turner Syndrome	Turner Syndrome	BEFREE	30245717		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	10861266, 17009408, 21925226		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	LHGDN	14669348, 17009408, 17990358		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	20826916, 25043669, 34410940, 9683296	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Incontinence Stress	Stress urinary incontinence	Pubtator	30715578	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	21338529, 27034707, 29436615, 30283446, 34116656	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	22853432		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	34587931	Stimulate	★☆☆☆☆ Found in Text Mining only
Varicose Veins	Varicose veins	Pubtator	12844106	Associate	★☆☆☆☆ Found in Text Mining only
Varicose Veins	Varicose veins	Pubtator	24505358	Inhibit	★☆☆☆☆ Found in Text Mining only
Varicosity	Vulval varices	BEFREE	12135949, 12175972, 19508478		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vasculitis Leukocytoclastic Cutaneous	Vasculitis	Pubtator	32461624	Stimulate	★☆☆☆☆ Found in Text Mining only
Ventricular Dysfunction Left	Ventricular dysfunction	Pubtator	35912721	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Ventricular remodeling	Pubtator	11216828	Associate	★☆☆☆☆ Found in Text Mining only
Von Hippel-Lindau Syndrome	Von Hippel-Lindau Syndrome	BEFREE	19551141		★☆☆☆☆ Found in Text Mining only
XERODERMA PIGMENTOSUM, COMPLEMENTATION GROUP C	Xeroderma Pigmentosum	BEFREE	21056989		★☆☆☆☆ Found in Text Mining only