Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	4300
Gene name	MLLT3 super elongation complex subunit
Gene symbol	MLLT3
Synonyms (NCBI Gene)	AF9YEATS3
Chromosome	9
Chromosome location	9p21.3

164

Show/Hide all (164)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022911	hsa-miR-124-3p	Microarray	18668037
MIRT508970	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT535872	hsa-miR-5692b	PAR-CLIP	20371350
MIRT535871	hsa-miR-5692c	PAR-CLIP	20371350
MIRT508975	hsa-miR-410-3p	PAR-CLIP	20371350
MIRT508974	hsa-miR-5011-5p	PAR-CLIP	20371350
MIRT508973	hsa-miR-511-3p	PAR-CLIP	20371350
MIRT508972	hsa-miR-223-5p	PAR-CLIP	20371350
MIRT508971	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT508969	hsa-miR-3924	PAR-CLIP	20371350
MIRT508975	hsa-miR-410-3p	PAR-CLIP	20371350
MIRT508974	hsa-miR-5011-5p	PAR-CLIP	20371350
MIRT508971	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT508969	hsa-miR-3924	PAR-CLIP	20371350
MIRT508970	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT508970	hsa-miR-1277-5p	PAR-CLIP	22012620
MIRT535872	hsa-miR-5692b	PAR-CLIP	22012620
MIRT535871	hsa-miR-5692c	PAR-CLIP	22012620
MIRT508975	hsa-miR-410-3p	PAR-CLIP	22012620
MIRT508974	hsa-miR-5011-5p	PAR-CLIP	22012620
MIRT508973	hsa-miR-511-3p	PAR-CLIP	22012620
MIRT508972	hsa-miR-223-5p	PAR-CLIP	22012620
MIRT508971	hsa-miR-190a-3p	PAR-CLIP	22012620
MIRT508969	hsa-miR-3924	PAR-CLIP	22012620
MIRT508975	hsa-miR-410-3p	PAR-CLIP	23446348
MIRT508974	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT508973	hsa-miR-511-3p	PAR-CLIP	23446348
MIRT508972	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT508971	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT508969	hsa-miR-3924	PAR-CLIP	23446348
MIRT508970	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT508970	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT535872	hsa-miR-5692b	PAR-CLIP	20371350
MIRT535871	hsa-miR-5692c	PAR-CLIP	20371350
MIRT508975	hsa-miR-410-3p	PAR-CLIP	20371350
MIRT508974	hsa-miR-5011-5p	PAR-CLIP	20371350
MIRT508973	hsa-miR-511-3p	PAR-CLIP	20371350
MIRT508972	hsa-miR-223-5p	PAR-CLIP	20371350
MIRT508971	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT508969	hsa-miR-3924	PAR-CLIP	20371350
MIRT508975	hsa-miR-410-3p	PAR-CLIP	20371350
MIRT508974	hsa-miR-5011-5p	PAR-CLIP	20371350
MIRT508971	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT508969	hsa-miR-3924	PAR-CLIP	20371350
MIRT508970	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT508970	hsa-miR-1277-5p	PAR-CLIP	22012620
MIRT535872	hsa-miR-5692b	PAR-CLIP	22012620
MIRT535871	hsa-miR-5692c	PAR-CLIP	22012620
MIRT508975	hsa-miR-410-3p	PAR-CLIP	22012620
MIRT508974	hsa-miR-5011-5p	PAR-CLIP	22012620
MIRT508973	hsa-miR-511-3p	PAR-CLIP	22012620
MIRT508972	hsa-miR-223-5p	PAR-CLIP	22012620
MIRT508971	hsa-miR-190a-3p	PAR-CLIP	22012620
MIRT508969	hsa-miR-3924	PAR-CLIP	22012620
MIRT508975	hsa-miR-410-3p	PAR-CLIP	23446348
MIRT508974	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT508973	hsa-miR-511-3p	PAR-CLIP	23446348
MIRT508972	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT508971	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT508969	hsa-miR-3924	PAR-CLIP	23446348
MIRT508970	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT1152149	hsa-miR-1237	CLIP-seq
MIRT1152150	hsa-miR-1248	CLIP-seq
MIRT1152151	hsa-miR-1283	CLIP-seq
MIRT1152152	hsa-miR-1299	CLIP-seq
MIRT1152153	hsa-miR-31	CLIP-seq
MIRT1152154	hsa-miR-3121-3p	CLIP-seq
MIRT1152155	hsa-miR-33a	CLIP-seq
MIRT1152156	hsa-miR-33b	CLIP-seq
MIRT1152157	hsa-miR-3653	CLIP-seq
MIRT1152158	hsa-miR-3658	CLIP-seq
MIRT1152159	hsa-miR-378g	CLIP-seq
MIRT1152160	hsa-miR-3974	CLIP-seq
MIRT1152161	hsa-miR-4328	CLIP-seq
MIRT1152162	hsa-miR-450b-3p	CLIP-seq
MIRT1152163	hsa-miR-4700-3p	CLIP-seq
MIRT1152164	hsa-miR-4709-5p	CLIP-seq
MIRT1152165	hsa-miR-4782-5p	CLIP-seq
MIRT1152166	hsa-miR-4796-3p	CLIP-seq
MIRT1152167	hsa-miR-488	CLIP-seq
MIRT1152168	hsa-miR-500a	CLIP-seq
MIRT1152169	hsa-miR-516b	CLIP-seq
MIRT1152170	hsa-miR-564	CLIP-seq
MIRT1152171	hsa-miR-570	CLIP-seq
MIRT1152172	hsa-miR-769-3p	CLIP-seq
MIRT1152173	hsa-miR-875-3p	CLIP-seq
MIRT2043341	hsa-miR-1253	CLIP-seq
MIRT2043342	hsa-miR-4426	CLIP-seq
MIRT2043343	hsa-miR-4434	CLIP-seq
MIRT2043344	hsa-miR-4516	CLIP-seq
MIRT2043345	hsa-miR-4531	CLIP-seq
MIRT2043346	hsa-miR-4647	CLIP-seq
MIRT2043347	hsa-miR-4662b	CLIP-seq
MIRT2043348	hsa-miR-4802-5p	CLIP-seq
MIRT2043349	hsa-miR-5095	CLIP-seq
MIRT2043350	hsa-miR-552	CLIP-seq
MIRT2043351	hsa-miR-603	CLIP-seq
MIRT1152173	hsa-miR-875-3p	CLIP-seq
MIRT2272725	hsa-miR-4436a	CLIP-seq
MIRT1152159	hsa-miR-378g	CLIP-seq
MIRT2571646	hsa-miR-1276	CLIP-seq
MIRT2571647	hsa-miR-1287	CLIP-seq
MIRT2571648	hsa-miR-2277-3p	CLIP-seq
MIRT2571649	hsa-miR-3065-5p	CLIP-seq
MIRT1152153	hsa-miR-31	CLIP-seq
MIRT2571650	hsa-miR-3135b	CLIP-seq
MIRT2571651	hsa-miR-3148	CLIP-seq
MIRT2571652	hsa-miR-3165	CLIP-seq
MIRT1152155	hsa-miR-33a	CLIP-seq
MIRT1152156	hsa-miR-33b	CLIP-seq
MIRT2571653	hsa-miR-374a	CLIP-seq
MIRT2571654	hsa-miR-374b	CLIP-seq
MIRT1152159	hsa-miR-378g	CLIP-seq
MIRT1152160	hsa-miR-3974	CLIP-seq
MIRT2571655	hsa-miR-3978	CLIP-seq
MIRT2571656	hsa-miR-409-3p	CLIP-seq
MIRT2571657	hsa-miR-4320	CLIP-seq
MIRT2571658	hsa-miR-4424	CLIP-seq
MIRT2272725	hsa-miR-4436a	CLIP-seq
MIRT2571659	hsa-miR-4502	CLIP-seq
MIRT1152162	hsa-miR-450b-3p	CLIP-seq
MIRT2571660	hsa-miR-4731-3p	CLIP-seq
MIRT1152166	hsa-miR-4796-3p	CLIP-seq
MIRT2571661	hsa-miR-4801	CLIP-seq
MIRT1152167	hsa-miR-488	CLIP-seq
MIRT2043349	hsa-miR-5095	CLIP-seq
MIRT2571662	hsa-miR-548n	CLIP-seq
MIRT2571663	hsa-miR-548t	CLIP-seq
MIRT2043350	hsa-miR-552	CLIP-seq
MIRT1152170	hsa-miR-564	CLIP-seq
MIRT2571664	hsa-miR-654-3p	CLIP-seq
MIRT1152172	hsa-miR-769-3p	CLIP-seq
MIRT2571665	hsa-miR-890	CLIP-seq
MIRT2571666	hsa-miR-891a	CLIP-seq
MIRT2571646	hsa-miR-1276	CLIP-seq
MIRT2571647	hsa-miR-1287	CLIP-seq
MIRT2571648	hsa-miR-2277-3p	CLIP-seq
MIRT2571649	hsa-miR-3065-5p	CLIP-seq
MIRT1152153	hsa-miR-31	CLIP-seq
MIRT2571650	hsa-miR-3135b	CLIP-seq
MIRT2571651	hsa-miR-3148	CLIP-seq
MIRT2571652	hsa-miR-3165	CLIP-seq
MIRT1152155	hsa-miR-33a	CLIP-seq
MIRT1152156	hsa-miR-33b	CLIP-seq
MIRT1152159	hsa-miR-378g	CLIP-seq
MIRT1152160	hsa-miR-3974	CLIP-seq
MIRT2571655	hsa-miR-3978	CLIP-seq
MIRT2571656	hsa-miR-409-3p	CLIP-seq
MIRT2571657	hsa-miR-4320	CLIP-seq
MIRT2571658	hsa-miR-4424	CLIP-seq
MIRT2272725	hsa-miR-4436a	CLIP-seq
MIRT1152162	hsa-miR-450b-3p	CLIP-seq
MIRT2571660	hsa-miR-4731-3p	CLIP-seq
MIRT1152166	hsa-miR-4796-3p	CLIP-seq
MIRT2571661	hsa-miR-4801	CLIP-seq
MIRT1152167	hsa-miR-488	CLIP-seq
MIRT2043349	hsa-miR-5095	CLIP-seq
MIRT2571662	hsa-miR-548n	CLIP-seq
MIRT2571663	hsa-miR-548t	CLIP-seq
MIRT2043350	hsa-miR-552	CLIP-seq
MIRT1152170	hsa-miR-564	CLIP-seq
MIRT1152172	hsa-miR-769-3p	CLIP-seq
MIRT2571665	hsa-miR-890	CLIP-seq
MIRT2571666	hsa-miR-891a	CLIP-seq

Show/Hide all (32)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IBA
GO:0003682	Function	Chromatin binding	IDA	25417107, 27105114
GO:0005515	Function	Protein binding	IPI	16189514, 20153263, 20203130, 21729782, 23145062, 23260655, 26496610, 28514442, 32296183, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	8506309
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0005829	Component	Cytosol	IDA
GO:0006325	Process	Chromatin organization	IEA
GO:0007379	Process	Segment specification	IEA
GO:0008023	Component	Transcription elongation factor complex	IBA
GO:0008023	Component	Transcription elongation factor complex	IDA	22195968, 25417107, 27105114
GO:0008023	Component	Transcription elongation factor complex	IEA
GO:0009952	Process	Anterior/posterior pattern specification	IEA
GO:0010467	Process	Gene expression	IEA
GO:0042393	Function	Histone binding	IDA	27105114, 27545619
GO:0045893	Process	Positive regulation of DNA-templated transcription	IBA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	25417107, 27105114, 31776511
GO:0060090	Function	Molecular adaptor activity	EXP	23260655
GO:0060218	Process	Hematopoietic stem cell differentiation	IDA	31776511
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IDA	19591803
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IGI	19591803
GO:0140030	Function	Modification-dependent protein binding	IDA	27105114, 27545619
GO:0140044	Function	Histone H3K18ac reader activity	IDA	25417107
GO:0140072	Function	Histone H3K9ac reader activity	IDA	25417107
GO:0140119	Function	Histone H3K27ac reader activity	IDA	25417107
GO:1902275	Process	Regulation of chromatin organization	IMP	31776511
GO:2000035	Process	Regulation of stem cell division	IDA	31776511
GO:2000096	Process	Positive regulation of Wnt signaling pathway, planar cell polarity pathway	IGI	19591803

MIM	HGNC	e!Ensembl
159558	7136	ENSG00000171843

P42568

Protein name

Protein AF-9 (ALL1-fused gene from chromosome 9 protein) (Myeloid/lymphoid or mixed-lineage leukemia translocated to chromosome 3 protein) (YEATS domain-containing protein 3)

Protein function

Chromatin reader component of the super elongation complex (SEC), a complex required to increase the catalytic rate of RNA polymerase II transcription by suppressing transient pausing by the polymerase at multiple sites along the DNA (PubMed:201

PDB

2LM0 , 2MV7 , 2N4Q , 2NDF , 2NDG , 4TMP , 5HJB , 5HJD , 5YYF , 6B7G , 6L5Z , 6LS6 , 6MIL , 6MIM , 7EIC , 7EID , 7VKG , 7VKH , 8PJ7 , 8TLV , 8TLW , 8TLX , 9ARO , 9ARR

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03366	YEATS	29 → 110	YEATS family	Domain
PF17793	AHD	503 → 563	ANC1 homology domain (AHD)	Domain

Tissue specificity

TISSUE SPECIFICITY: Enriched in undifferentiated hematopoietic stem cells in fetal liver, cord blood and bone marrow. {ECO:0000269|PubMed:31776511}.

Sequence

MASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEKVVFHLHESFP
RPKRVCKDPPYKVEESGYAGFILPIEVYFKNKEEPRKVRFDYDLFLHLEGHPPVNHLRCE
KLTFNNPTEDFRRKLLKAGGDPNRSIHTSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS
SSSSSSSSSSTSFSKPHKLMKEHKEKPSKDSREHKSAFKEPSRDHNKSSKESSKKPKENK
PLKEEKIVPKMAFKEPKPMSKEPKPDSNLLTITSGQDKKAPSKRPPISDSEELSAKKRKK
SSSEALFKSFSSAPPLILTCSADKKQIKDKSHVKMGKVKIESETSEKKKSTLPPFDDIVD
PNDSDVEENISSKSDSEQPSPASSSSSSSSSFTPSQTRQQGPLRSIMKDLHSDDNEEESD
EVEDNDNDSEMERPVNRGGSRSRRVSLSDGSDSESSSASSPLHHEPPPPLLKTNNNQILE
VKSPIKQSKSDKQIKNGECDKAYLDELVELHRRLMTLRERHILQQIVNLIEETGHFHITN
TTFDFDLCSLDKTTVRKLQSYLETSGTS

Sequence length

568

Interactions

View interactions

	KEGG		Reactome
	Viral life cycle - HIV-1 Transcriptional misregulation in cancer		Formation of RNA Pol II elongation complex RNA Polymerase II Pre-transcription Events RNA Polymerase II Transcription Elongation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (15)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTROCYTOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC KIDNEY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (31)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute leukemia	Leukemia	BEFREE	18474298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	16001262, 27282883, 29649994, 9331569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Megakaryocytic Leukemias	Megakaryocytic Leukemia	BEFREE	26215111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	20395514, 28595195, 28871137, 8414510		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute myeloid leukemia with t(9;11)(p22;q23)	Myeloid Leukemia With T(9;11)(P22;Q23)	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute myeloid leukemia, 11q23 abnormalities	Myeloid Leukemia, 11q23 Abnormalities	BEFREE	20395514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	9331569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	GWASCAT_DG	26083242		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	20874815		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	25843568, 9331569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chromosome 5q Deletion Syndrome	Chromosome 5q deletion syndrome	Pubtator	30514321	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	8506309		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	16001262		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	20805992	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	37266442	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	15269783, 19748670, 20656931, 24517546, 25843568, 29164580, 29720585, 8414510, 8630974		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	17726105, 17875318, 20656931, 29164580, 36585787	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	16630339, 18931459, 21474990, 21900057, 22846743, 23091311, 24150221, 24769646, 26419938, 29477140, 30381403, 30387535, 33375773, 33419897, 33469688 View all (5 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	12242306, 15188459, 16001262, 16450356, 17284365, 18068534, 20395514, 22845170, 23772754, 24991719, 28595195, 28871137, 30203571, 31789407, 9331569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	16086288		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10393173, 30132510, 31273053		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	30132510		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	29649994, 30514321, 30646906		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	30514321, 30646906	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	31273053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	16001262, 27282883		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	LHGDN	16215946		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	29164580	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	20874815		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of mouth	Oral cavity carcinoma	BEFREE	31273053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	30272326	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

MLLT3 (MLLT3 super elongation complex subunit)