ASCL2 (achaete-scute family bHLH transcription factor 2)

Gene

• Entrez ID: 430
• Gene name: Achaete-scute family bHLH transcription factor 2
• Gene symbol: ASCL2
• Synonyms (NCBI Gene): ASH2, HASH2, MASH2, bHLHa45
• Chromosome: 11
• Chromosome location: 11p15.5
• Summary: This gene is a member of the basic helix-loop-helix (BHLH) family of transcription factors. It activates transcription by binding to the E box (5`-CANNTG-3`). Dimerization with other BHLH proteins is required for efficient DNA binding. Involved in the det

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018430	hsa-miR-335-5p	Microarray	18185580
MIRT723361	hsa-miR-211-3p	HITS-CLIP	19536157
MIRT723360	hsa-miR-4270	HITS-CLIP	19536157
MIRT723359	hsa-miR-4441	HITS-CLIP	19536157
MIRT723358	hsa-miR-6754-5p	HITS-CLIP	19536157
MIRT723357	hsa-miR-7113-5p	HITS-CLIP	19536157
MIRT723356	hsa-miR-7108-3p	HITS-CLIP	19536157
MIRT723355	hsa-miR-1266-5p	HITS-CLIP	19536157
MIRT723354	hsa-miR-4518	HITS-CLIP	19536157
MIRT723353	hsa-miR-4749-3p	HITS-CLIP	19536157
MIRT489232	hsa-miR-134-3p	PAR-CLIP	24398324
MIRT489231	hsa-miR-3184-5p	PAR-CLIP	24398324
MIRT489230	hsa-miR-423-5p	PAR-CLIP	24398324
MIRT489228	hsa-miR-766-5p	PAR-CLIP	24398324
MIRT489227	hsa-miR-4467	PAR-CLIP	24398324
MIRT489226	hsa-miR-149-3p	PAR-CLIP	24398324
MIRT489225	hsa-miR-4728-5p	PAR-CLIP	24398324
MIRT489224	hsa-miR-6785-5p	PAR-CLIP	24398324
MIRT489223	hsa-miR-6883-5p	PAR-CLIP	24398324
MIRT489221	hsa-miR-3175	PAR-CLIP	24398324
MIRT489222	hsa-miR-1343-5p	PAR-CLIP	24398324
MIRT489220	hsa-miR-939-5p	PAR-CLIP	24398324
MIRT489219	hsa-miR-6825-5p	PAR-CLIP	24398324
MIRT489218	hsa-miR-3180	PAR-CLIP	24398324
MIRT489217	hsa-miR-3180-3p	PAR-CLIP	24398324
MIRT489216	hsa-miR-3196	PAR-CLIP	24398324
MIRT489215	hsa-miR-6816-5p	PAR-CLIP	24398324
MIRT489214	hsa-miR-491-5p	PAR-CLIP	24398324
MIRT489213	hsa-miR-3151-5p	PAR-CLIP	24398324
MIRT489212	hsa-miR-4447	PAR-CLIP	24398324
MIRT489211	hsa-miR-4472	PAR-CLIP	24398324
MIRT489210	hsa-miR-6742-5p	PAR-CLIP	24398324
MIRT489209	hsa-miR-3150a-3p	PAR-CLIP	24398324
MIRT489208	hsa-miR-6763-5p	PAR-CLIP	24398324
MIRT489207	hsa-miR-6796-5p	PAR-CLIP	24398324
MIRT489232	hsa-miR-134-3p	PAR-CLIP	23592263
MIRT489231	hsa-miR-3184-5p	PAR-CLIP	23592263
MIRT489230	hsa-miR-423-5p	PAR-CLIP	23592263
MIRT489229	hsa-miR-671-5p	PAR-CLIP	23592263
MIRT489228	hsa-miR-766-5p	PAR-CLIP	23592263
MIRT489227	hsa-miR-4467	PAR-CLIP	23592263
MIRT489226	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT489225	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT489224	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT489223	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT489221	hsa-miR-3175	PAR-CLIP	23592263
MIRT489222	hsa-miR-1343-5p	PAR-CLIP	23592263
MIRT489220	hsa-miR-939-5p	PAR-CLIP	23592263
MIRT489219	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT489218	hsa-miR-3180	PAR-CLIP	23592263
MIRT489217	hsa-miR-3180-3p	PAR-CLIP	23592263
MIRT489216	hsa-miR-3196	PAR-CLIP	23592263
MIRT489215	hsa-miR-6816-5p	PAR-CLIP	23592263
MIRT489214	hsa-miR-491-5p	PAR-CLIP	23592263
MIRT489213	hsa-miR-3151-5p	PAR-CLIP	23592263
MIRT489212	hsa-miR-4447	PAR-CLIP	23592263
MIRT489211	hsa-miR-4472	PAR-CLIP	23592263
MIRT489210	hsa-miR-6742-5p	PAR-CLIP	23592263
MIRT489209	hsa-miR-3150a-3p	PAR-CLIP	23592263
MIRT489208	hsa-miR-6763-5p	PAR-CLIP	23592263
MIRT489207	hsa-miR-6796-5p	PAR-CLIP	23592263
MIRT439132	hsa-miR-10b-5p	3'LIFE	25074381
MIRT439132	hsa-miR-10b-5p	3'LIFE	25074381
MIRT723361	hsa-miR-211-3p	HITS-CLIP	19536157
MIRT723360	hsa-miR-4270	HITS-CLIP	19536157
MIRT723359	hsa-miR-4441	HITS-CLIP	19536157
MIRT723358	hsa-miR-6754-5p	HITS-CLIP	19536157
MIRT723357	hsa-miR-7113-5p	HITS-CLIP	19536157
MIRT723356	hsa-miR-7108-3p	HITS-CLIP	19536157
MIRT723355	hsa-miR-1266-5p	HITS-CLIP	19536157
MIRT723354	hsa-miR-4518	HITS-CLIP	19536157
MIRT723353	hsa-miR-4749-3p	HITS-CLIP	19536157
MIRT489232	hsa-miR-134-3p	PAR-CLIP	24398324
MIRT489231	hsa-miR-3184-5p	PAR-CLIP	24398324
MIRT489230	hsa-miR-423-5p	PAR-CLIP	24398324
MIRT489228	hsa-miR-766-5p	PAR-CLIP	24398324
MIRT489227	hsa-miR-4467	PAR-CLIP	24398324
MIRT489226	hsa-miR-149-3p	PAR-CLIP	24398324
MIRT489225	hsa-miR-4728-5p	PAR-CLIP	24398324
MIRT489224	hsa-miR-6785-5p	PAR-CLIP	24398324
MIRT489223	hsa-miR-6883-5p	PAR-CLIP	24398324
MIRT489221	hsa-miR-3175	PAR-CLIP	24398324
MIRT489222	hsa-miR-1343-5p	PAR-CLIP	24398324
MIRT489220	hsa-miR-939-5p	PAR-CLIP	24398324
MIRT489219	hsa-miR-6825-5p	PAR-CLIP	24398324
MIRT489218	hsa-miR-3180	PAR-CLIP	24398324
MIRT489217	hsa-miR-3180-3p	PAR-CLIP	24398324
MIRT489216	hsa-miR-3196	PAR-CLIP	24398324
MIRT489215	hsa-miR-6816-5p	PAR-CLIP	24398324
MIRT489214	hsa-miR-491-5p	PAR-CLIP	24398324
MIRT489213	hsa-miR-3151-5p	PAR-CLIP	24398324
MIRT489212	hsa-miR-4447	PAR-CLIP	24398324
MIRT489211	hsa-miR-4472	PAR-CLIP	24398324
MIRT489210	hsa-miR-6742-5p	PAR-CLIP	24398324
MIRT489209	hsa-miR-3150a-3p	PAR-CLIP	24398324
MIRT489208	hsa-miR-6763-5p	PAR-CLIP	24398324
MIRT489207	hsa-miR-6796-5p	PAR-CLIP	24398324
MIRT489232	hsa-miR-134-3p	PAR-CLIP	23592263
MIRT489231	hsa-miR-3184-5p	PAR-CLIP	23592263
MIRT489230	hsa-miR-423-5p	PAR-CLIP	23592263
MIRT489229	hsa-miR-671-5p	PAR-CLIP	23592263
MIRT489228	hsa-miR-766-5p	PAR-CLIP	23592263
MIRT489227	hsa-miR-4467	PAR-CLIP	23592263
MIRT489226	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT489225	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT489224	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT489223	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT489221	hsa-miR-3175	PAR-CLIP	23592263
MIRT489222	hsa-miR-1343-5p	PAR-CLIP	23592263
MIRT489220	hsa-miR-939-5p	PAR-CLIP	23592263
MIRT489219	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT489218	hsa-miR-3180	PAR-CLIP	23592263
MIRT489217	hsa-miR-3180-3p	PAR-CLIP	23592263
MIRT489216	hsa-miR-3196	PAR-CLIP	23592263
MIRT489215	hsa-miR-6816-5p	PAR-CLIP	23592263
MIRT489214	hsa-miR-491-5p	PAR-CLIP	23592263
MIRT489213	hsa-miR-3151-5p	PAR-CLIP	23592263
MIRT489212	hsa-miR-4447	PAR-CLIP	23592263
MIRT489211	hsa-miR-4472	PAR-CLIP	23592263
MIRT489210	hsa-miR-6742-5p	PAR-CLIP	23592263
MIRT489209	hsa-miR-3150a-3p	PAR-CLIP	23592263
MIRT489208	hsa-miR-6763-5p	PAR-CLIP	23592263
MIRT489207	hsa-miR-6796-5p	PAR-CLIP	23592263
MIRT802683	hsa-miR-1256	CLIP-seq
MIRT802684	hsa-miR-3155	CLIP-seq
MIRT802685	hsa-miR-3155b	CLIP-seq
MIRT802686	hsa-miR-3692	CLIP-seq
MIRT802687	hsa-miR-4267	CLIP-seq
MIRT802688	hsa-miR-4505	CLIP-seq
MIRT802689	hsa-miR-4726-3p	CLIP-seq
MIRT802690	hsa-miR-4743	CLIP-seq
MIRT802691	hsa-miR-484	CLIP-seq
MIRT802692	hsa-miR-556-3p	CLIP-seq
MIRT802693	hsa-miR-615-5p	CLIP-seq
MIRT1937028	hsa-miR-338-3p	CLIP-seq
MIRT1937029	hsa-miR-4530	CLIP-seq
MIRT2176801	hsa-miR-1202	CLIP-seq
MIRT2176802	hsa-miR-1207-5p	CLIP-seq
MIRT2176803	hsa-miR-1282	CLIP-seq
MIRT2176804	hsa-miR-1468	CLIP-seq
MIRT2176805	hsa-miR-1470	CLIP-seq
MIRT2176806	hsa-miR-1909	CLIP-seq
MIRT2176807	hsa-miR-3148	CLIP-seq
MIRT2176808	hsa-miR-3194-5p	CLIP-seq
MIRT1937028	hsa-miR-338-3p	CLIP-seq
MIRT2176809	hsa-miR-3605-3p	CLIP-seq
MIRT2176810	hsa-miR-3657	CLIP-seq
MIRT2176811	hsa-miR-3688-3p	CLIP-seq
MIRT2176812	hsa-miR-3972	CLIP-seq
MIRT2176813	hsa-miR-4435	CLIP-seq
MIRT2176814	hsa-miR-4488	CLIP-seq
MIRT2176815	hsa-miR-4519	CLIP-seq
MIRT1937029	hsa-miR-4530	CLIP-seq
MIRT2176816	hsa-miR-4660	CLIP-seq
MIRT2176817	hsa-miR-4667-3p	CLIP-seq
MIRT2176818	hsa-miR-4697-5p	CLIP-seq
MIRT2176819	hsa-miR-4727-3p	CLIP-seq
MIRT2176820	hsa-miR-4763-3p	CLIP-seq
MIRT2176821	hsa-miR-4776-3p	CLIP-seq
MIRT2176822	hsa-miR-486-3p	CLIP-seq
MIRT2176823	hsa-miR-508-5p	CLIP-seq
MIRT802692	hsa-miR-556-3p	CLIP-seq
MIRT802693	hsa-miR-615-5p	CLIP-seq
MIRT2176824	hsa-miR-646	CLIP-seq
MIRT2176825	hsa-miR-766	CLIP-seq
MIRT2384524	hsa-miR-4758-3p	CLIP-seq
MIRT2176805	hsa-miR-1470	CLIP-seq
MIRT1937028	hsa-miR-338-3p	CLIP-seq
MIRT2176810	hsa-miR-3657	CLIP-seq
MIRT1937029	hsa-miR-4530	CLIP-seq
MIRT2176816	hsa-miR-4660	CLIP-seq
MIRT2176817	hsa-miR-4667-3p	CLIP-seq
MIRT2176824	hsa-miR-646	CLIP-seq
MIRT2176825	hsa-miR-766	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
USF1	Repression	12917334
USF2	Repression	12917334

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	14561729
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	14561729
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	14561729
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001666	Process	Response to hypoxia	IEP	14561729
GO:0001701	Process	In utero embryonic development	IEA
GO:0001890	Process	Placenta development	IEA
GO:0001890	Process	Placenta development	NAS	14561729
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005634	Component	Nucleus	IDA	11440538
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IDA	12917334
GO:0005737	Component	Cytoplasm	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0007423	Process	Sensory organ development	IBA
GO:0010626	Process	Negative regulation of Schwann cell proliferation	IEA
GO:0019827	Process	Stem cell population maintenance	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030182	Process	Neuron differentiation	IBA
GO:0030217	Process	T cell differentiation	IEA
GO:0035019	Process	Somatic stem cell population maintenance	IEA
GO:0043425	Function	BHLH transcription factor binding	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045626	Process	Negative regulation of T-helper 1 cell differentiation	IEA
GO:0045629	Process	Negative regulation of T-helper 2 cell differentiation	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046983	Function	Protein dimerization activity	IEA
GO:0050767	Process	Regulation of neurogenesis	IBA
GO:0060712	Process	Spongiotrophoblast layer development	IEP	12917334
GO:0060719	Process	Chorionic trophoblast cell development	IEA
GO:0061470	Process	T follicular helper cell differentiation	IEA
GO:0070888	Function	E-box binding	IDA	14561729
GO:0070888	Function	E-box binding	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IBA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:2000320	Process	Negative regulation of T-helper 17 cell differentiation	IEA
GO:2000406	Process	Positive regulation of T cell migration	IEA

Other IDs

• MIM: 601886
• HGNC: 739
• e!Ensembl: ENSG00000183734

Protein

• UniProt ID: Q99929
• Protein name: Achaete-scute homolog 2 (ASH-2) (hASH2) (Class A basic helix-loop-helix protein 45) (bHLHa45) (Mash2)
• Protein function: Transcription factor. Binds to E-box motifs 5'-CANNTG-3' in the regulatory elements of target genes, probably as a heterodimer with another basic helix-loop-helix (bHLH) protein such as the transcription factor TCF3. May bind both open and close
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00010	HLH	51 → 103	Helix-loop-helix DNA-binding domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in the placenta at a stage between the first and second trimesters and when it matures, at about 32-36 weeks (PubMed:12099555). Expressed in the extravillous trophoblasts, the intermediate trophoblasts, and at lower levels in
• Sequence:

  MDGGTLPRSAPPAPPVPVGCAARRRPASPELLRCSRRRRPATAETGGGAAAVARRNERER
  NRVKLVNLGFQALRQHVPHGGASKKLSKVETLRSAVEYIRALQRLLAEHDAVRNALAGGL
  RPQAVRPSAPRGPPGTTPVAASPSRASSSPGRGGSSEPGSPRSAYSSDDSGCEGALSPAE
  RELLDFSSWLGGY

• Sequence length: 193

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANKYLOSING SPONDYLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC LYMPHOCYTIC LEUKEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC EYE DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEUROPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC RETINOPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OROFACIAL CLEFT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SARCOIDOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES NEPHROPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenoma	Adenoma	BEFREE	22637696		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	30682058		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	24650279	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	30722992, 31539517		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	28728856		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	28469967		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	33461604	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	35660018	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	19896696		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	22610075	Associate	★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	LHGDN	17165436		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	30722992		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	25371200, 29312609, 29551399, 29886802, 31549316		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	CTD_human_DG	15059925		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic neoplasm	Pubtator	35774798	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Carcinoma	Colorectal Cancer	BEFREE	20479215, 22637696, 25277775, 25866254, 26307678, 28899657, 29312609, 29551399, 29886802, 30682058, 30706227, 31549316		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25371200, 26307678, 34059508, 35660018, 35670012, 37310750	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	29886802, 33628843	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	30718926		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	24623538		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	24623538	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	35882624	Associate	★☆☆☆☆ Found in Text Mining only
Hydatidiform Mole	Hydatidiform Mole	LHGDN	17165436		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	30722992		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	19896696		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	28469967		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	24623538		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	23181270, 30106147		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22637696, 25746000, 29312609, 29746925		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	CTD_human_DG	15059925		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	25371200, 29312609, 29551399, 29886802, 31549316		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	28469967		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	30006149		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	30006149	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18245475, 24340024, 25277775, 25287138, 28469967, 29551399, 30106147, 30682058		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	29789573, 37995683	Associate	★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	30706227		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	23181270, 29746925, 30106147		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	23181270, 30106147		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	23181270, 30106147, 36008864	Associate	★☆☆☆☆ Found in Text Mining only