Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	4296
Gene name	Mitogen-activated protein kinase kinase kinase 11
Gene symbol	MAP3K11
Synonyms (NCBI Gene)	MEKK11MLK-3MLK3PTK1SPRK
Chromosome	11
Chromosome location	11q13.1
Summary	The protein encoded by this gene is a member of the serine/threonine kinase family. This kinase contains a SH3 domain and a leucine zipper-basic motif. This kinase preferentially activates MAPK8/JNK kinase, and functions as a positive regulator of JNK sig

194

Show/Hide all (194)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005873	hsa-miR-199a-5p	Luciferase reporter assayqRT-PCRWestern blot	21048306
MIRT005873	hsa-miR-199a-5p	Luciferase reporter assayqRT-PCRWestern blot	21048306
MIRT053660	hsa-miR-145-5p	Microarray	22942087
MIRT438462	hsa-miR-138-5p	Luciferase reporter assay	24211202
MIRT438462	hsa-miR-138-5p	Luciferase reporter assay	24211202
MIRT438462	hsa-miR-138-5p	Luciferase reporter assay	24211202
MIRT438462	hsa-miR-138-5p	Luciferase reporter assay	24211202
MIRT440288	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT440288	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT005873	hsa-miR-199a-5p	Luciferase reporter assay	26885275
MIRT005873	hsa-miR-199a-5p	Luciferase reporter assay	26885275
MIRT005873	hsa-miR-199a-5p	Luciferase reporter assay	26885275
MIRT731595	hsa-miR-125b-5p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	26138442
MIRT731595	hsa-miR-125b-5p	Luciferase reporter assayqRT-PCRWestern blot	27613090
MIRT005873	hsa-miR-199a-5p	Luciferase reporter assay	26717044
MIRT005873	hsa-miR-199a-5p	Luciferase reporter assay	26717044
MIRT005873	hsa-miR-199a-5p	Luciferase reporter assay	26717044
MIRT005873	hsa-miR-199a-5p	Luciferase reporter assay	26717044
MIRT1128130	hsa-miR-106a	CLIP-seq
MIRT1128131	hsa-miR-106b	CLIP-seq
MIRT1128132	hsa-miR-1207-5p	CLIP-seq
MIRT1128133	hsa-miR-1243	CLIP-seq
MIRT1128134	hsa-miR-1245b-3p	CLIP-seq
MIRT1128135	hsa-miR-1286	CLIP-seq
MIRT1128136	hsa-miR-138	CLIP-seq
MIRT1128137	hsa-miR-149	CLIP-seq
MIRT1128138	hsa-miR-17	CLIP-seq
MIRT1128139	hsa-miR-1827	CLIP-seq
MIRT1128140	hsa-miR-1909	CLIP-seq
MIRT1128141	hsa-miR-20a	CLIP-seq
MIRT1128142	hsa-miR-20b	CLIP-seq
MIRT1128143	hsa-miR-2110	CLIP-seq
MIRT1128144	hsa-miR-2277-3p	CLIP-seq
MIRT1128145	hsa-miR-299-3p	CLIP-seq
MIRT1128146	hsa-miR-302a	CLIP-seq
MIRT1128147	hsa-miR-302b	CLIP-seq
MIRT1128148	hsa-miR-302c	CLIP-seq
MIRT1128149	hsa-miR-302d	CLIP-seq
MIRT1128150	hsa-miR-302e	CLIP-seq
MIRT1128151	hsa-miR-3064-5p	CLIP-seq
MIRT1128152	hsa-miR-3151	CLIP-seq
MIRT1128153	hsa-miR-372	CLIP-seq
MIRT1128154	hsa-miR-373	CLIP-seq
MIRT1128155	hsa-miR-3942-3p	CLIP-seq
MIRT1128156	hsa-miR-4271	CLIP-seq
MIRT1128157	hsa-miR-4292	CLIP-seq
MIRT1128158	hsa-miR-4299	CLIP-seq
MIRT1128159	hsa-miR-4308	CLIP-seq
MIRT1128160	hsa-miR-4420	CLIP-seq
MIRT1128161	hsa-miR-4436b-3p	CLIP-seq
MIRT1128162	hsa-miR-4447	CLIP-seq
MIRT1128163	hsa-miR-4472	CLIP-seq
MIRT1128164	hsa-miR-4488	CLIP-seq
MIRT1128165	hsa-miR-4649-3p	CLIP-seq
MIRT1128166	hsa-miR-4667-5p	CLIP-seq
MIRT1128167	hsa-miR-4690-5p	CLIP-seq
MIRT1128168	hsa-miR-4697-5p	CLIP-seq
MIRT1128169	hsa-miR-4700-5p	CLIP-seq
MIRT1128170	hsa-miR-4725-3p	CLIP-seq
MIRT1128171	hsa-miR-4738-3p	CLIP-seq
MIRT1128172	hsa-miR-4740-3p	CLIP-seq
MIRT1128173	hsa-miR-4761-3p	CLIP-seq
MIRT1128174	hsa-miR-4763-3p	CLIP-seq
MIRT1128175	hsa-miR-4794	CLIP-seq
MIRT1128176	hsa-miR-491-5p	CLIP-seq
MIRT1128177	hsa-miR-512-3p	CLIP-seq
MIRT1128178	hsa-miR-519d	CLIP-seq
MIRT1128179	hsa-miR-520a-3p	CLIP-seq
MIRT1128180	hsa-miR-520b	CLIP-seq
MIRT1128181	hsa-miR-520c-3p	CLIP-seq
MIRT1128182	hsa-miR-520d-3p	CLIP-seq
MIRT1128183	hsa-miR-520e	CLIP-seq
MIRT1128184	hsa-miR-542-3p	CLIP-seq
MIRT1128185	hsa-miR-548t	CLIP-seq
MIRT1128186	hsa-miR-576-3p	CLIP-seq
MIRT1128187	hsa-miR-93	CLIP-seq
MIRT2036456	hsa-miR-1236	CLIP-seq
MIRT1128136	hsa-miR-138	CLIP-seq
MIRT2036457	hsa-miR-145	CLIP-seq
MIRT1128137	hsa-miR-149	CLIP-seq
MIRT2036458	hsa-miR-1915	CLIP-seq
MIRT1128144	hsa-miR-2277-3p	CLIP-seq
MIRT1128145	hsa-miR-299-3p	CLIP-seq
MIRT1128151	hsa-miR-3064-5p	CLIP-seq
MIRT2036459	hsa-miR-3130-3p	CLIP-seq
MIRT2036460	hsa-miR-361-3p	CLIP-seq
MIRT1128158	hsa-miR-4299	CLIP-seq
MIRT1128161	hsa-miR-4436b-3p	CLIP-seq
MIRT2036461	hsa-miR-4459	CLIP-seq
MIRT1128165	hsa-miR-4649-3p	CLIP-seq
MIRT2036462	hsa-miR-4667-3p	CLIP-seq
MIRT2036463	hsa-miR-4685-5p	CLIP-seq
MIRT2036464	hsa-miR-4711-5p	CLIP-seq
MIRT2036465	hsa-miR-4722-5p	CLIP-seq
MIRT2036466	hsa-miR-4749-3p	CLIP-seq
MIRT1128175	hsa-miR-4794	CLIP-seq
MIRT1128184	hsa-miR-542-3p	CLIP-seq
MIRT2036467	hsa-miR-670	CLIP-seq
MIRT2036457	hsa-miR-145	CLIP-seq
MIRT2266702	hsa-miR-1825	CLIP-seq
MIRT2266703	hsa-miR-199b-5p	CLIP-seq
MIRT2266704	hsa-miR-214	CLIP-seq
MIRT1128151	hsa-miR-3064-5p	CLIP-seq
MIRT2266705	hsa-miR-3619-5p	CLIP-seq
MIRT2266706	hsa-miR-3652	CLIP-seq
MIRT2266707	hsa-miR-3910	CLIP-seq
MIRT2266708	hsa-miR-4267	CLIP-seq
MIRT1128157	hsa-miR-4292	CLIP-seq
MIRT1128159	hsa-miR-4308	CLIP-seq
MIRT2266709	hsa-miR-4430	CLIP-seq
MIRT1128161	hsa-miR-4436b-3p	CLIP-seq
MIRT2266710	hsa-miR-4476	CLIP-seq
MIRT2266711	hsa-miR-4505	CLIP-seq
MIRT2266712	hsa-miR-4651	CLIP-seq
MIRT2266713	hsa-miR-4728-3p	CLIP-seq
MIRT2266714	hsa-miR-4731-5p	CLIP-seq
MIRT1128173	hsa-miR-4761-3p	CLIP-seq
MIRT2266715	hsa-miR-486-3p	CLIP-seq
MIRT2266716	hsa-miR-608	CLIP-seq
MIRT2266717	hsa-miR-615-5p	CLIP-seq
MIRT2266718	hsa-miR-761	CLIP-seq
MIRT2438486	hsa-miR-1207-3p	CLIP-seq
MIRT2438487	hsa-miR-1225-5p	CLIP-seq
MIRT2438488	hsa-miR-150	CLIP-seq
MIRT2266704	hsa-miR-214	CLIP-seq
MIRT2438489	hsa-miR-3155	CLIP-seq
MIRT2438490	hsa-miR-3155b	CLIP-seq
MIRT2266705	hsa-miR-3619-5p	CLIP-seq
MIRT2438491	hsa-miR-3663-5p	CLIP-seq
MIRT2266707	hsa-miR-3910	CLIP-seq
MIRT2438492	hsa-miR-4438	CLIP-seq
MIRT2266710	hsa-miR-4476	CLIP-seq
MIRT2266714	hsa-miR-4731-5p	CLIP-seq
MIRT2438493	hsa-miR-484	CLIP-seq
MIRT2266715	hsa-miR-486-3p	CLIP-seq
MIRT2438494	hsa-miR-520a-5p	CLIP-seq
MIRT2438495	hsa-miR-525-5p	CLIP-seq
MIRT2438496	hsa-miR-760	CLIP-seq
MIRT2266718	hsa-miR-761	CLIP-seq
MIRT2438486	hsa-miR-1207-3p	CLIP-seq
MIRT2438487	hsa-miR-1225-5p	CLIP-seq
MIRT2438488	hsa-miR-150	CLIP-seq
MIRT2438489	hsa-miR-3155	CLIP-seq
MIRT2438490	hsa-miR-3155b	CLIP-seq
MIRT2438491	hsa-miR-3663-5p	CLIP-seq
MIRT2438492	hsa-miR-4438	CLIP-seq
MIRT2438493	hsa-miR-484	CLIP-seq
MIRT2438496	hsa-miR-760	CLIP-seq
MIRT1128130	hsa-miR-106a	CLIP-seq
MIRT1128131	hsa-miR-106b	CLIP-seq
MIRT1128135	hsa-miR-1286	CLIP-seq
MIRT1128138	hsa-miR-17	CLIP-seq
MIRT1128141	hsa-miR-20a	CLIP-seq
MIRT1128142	hsa-miR-20b	CLIP-seq
MIRT1128146	hsa-miR-302a	CLIP-seq
MIRT1128147	hsa-miR-302b	CLIP-seq
MIRT1128148	hsa-miR-302c	CLIP-seq
MIRT1128149	hsa-miR-302d	CLIP-seq
MIRT1128150	hsa-miR-302e	CLIP-seq
MIRT1128153	hsa-miR-372	CLIP-seq
MIRT1128154	hsa-miR-373	CLIP-seq
MIRT1128167	hsa-miR-4690-5p	CLIP-seq
MIRT1128177	hsa-miR-512-3p	CLIP-seq
MIRT1128178	hsa-miR-519d	CLIP-seq
MIRT1128179	hsa-miR-520a-3p	CLIP-seq
MIRT1128180	hsa-miR-520b	CLIP-seq
MIRT1128181	hsa-miR-520c-3p	CLIP-seq
MIRT1128182	hsa-miR-520d-3p	CLIP-seq
MIRT1128183	hsa-miR-520e	CLIP-seq
MIRT1128185	hsa-miR-548t	CLIP-seq
MIRT1128187	hsa-miR-93	CLIP-seq
MIRT1128130	hsa-miR-106a	CLIP-seq
MIRT1128131	hsa-miR-106b	CLIP-seq
MIRT1128135	hsa-miR-1286	CLIP-seq
MIRT1128138	hsa-miR-17	CLIP-seq
MIRT1128141	hsa-miR-20a	CLIP-seq
MIRT1128142	hsa-miR-20b	CLIP-seq
MIRT1128146	hsa-miR-302a	CLIP-seq
MIRT1128147	hsa-miR-302b	CLIP-seq
MIRT1128148	hsa-miR-302c	CLIP-seq
MIRT1128149	hsa-miR-302d	CLIP-seq
MIRT1128150	hsa-miR-302e	CLIP-seq
MIRT1128153	hsa-miR-372	CLIP-seq
MIRT1128154	hsa-miR-373	CLIP-seq
MIRT1128167	hsa-miR-4690-5p	CLIP-seq
MIRT1128177	hsa-miR-512-3p	CLIP-seq
MIRT1128178	hsa-miR-519d	CLIP-seq
MIRT1128179	hsa-miR-520a-3p	CLIP-seq
MIRT1128180	hsa-miR-520b	CLIP-seq
MIRT1128181	hsa-miR-520c-3p	CLIP-seq
MIRT1128182	hsa-miR-520d-3p	CLIP-seq
MIRT1128183	hsa-miR-520e	CLIP-seq
MIRT1128185	hsa-miR-548t	CLIP-seq
MIRT1128187	hsa-miR-93	CLIP-seq

Show/Hide all (46)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	IMP	15258589
GO:0000166	Function	Nucleotide binding	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004672	Function	Protein kinase activity	TAS	8183572, 10799501
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	8195146
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	TAS	10799501
GO:0004706	Function	JUN kinase kinase kinase activity	IBA
GO:0004706	Function	JUN kinase kinase kinase activity	IEA
GO:0004706	Function	JUN kinase kinase kinase activity	IMP	15258589
GO:0004706	Function	JUN kinase kinase kinase activity	ISS
GO:0004709	Function	MAP kinase kinase kinase activity	IEA
GO:0004709	Function	MAP kinase kinase kinase activity	IMP	15258589
GO:0005515	Function	Protein binding	IPI	9003777, 20890305, 23857585, 25241761
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IBA
GO:0005813	Component	Centrosome	IDA	12529434
GO:0005813	Component	Centrosome	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IDA	12529434
GO:0006468	Process	Protein phosphorylation	IDA	11053428
GO:0007017	Process	Microtubule-based process	IBA
GO:0007017	Process	Microtubule-based process	IMP	12529434
GO:0007254	Process	JNK cascade	IBA
GO:0007254	Process	JNK cascade	IEA
GO:0007254	Process	JNK cascade	IMP	15258589
GO:0007254	Process	JNK cascade	TAS	10799501
GO:0016020	Component	Membrane	HDA	19946888
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0031267	Function	Small GTPase binding	IEA
GO:0031434	Function	Mitogen-activated protein kinase kinase binding	IEA
GO:0031435	Function	Mitogen-activated protein kinase kinase kinase binding	IPI	17584736
GO:0042802	Function	Identical protein binding	IPI	9829970
GO:0042803	Function	Protein homodimerization activity	IPI	9829970
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043507	Process	Positive regulation of JUN kinase activity	IMP	17584736
GO:0043525	Process	Positive regulation of neuron apoptotic process	IEA
GO:0044843	Process	Cell cycle G1/S phase transition	IMP	15258589
GO:0046330	Process	Positive regulation of JNK cascade	IEA
GO:0046330	Process	Positive regulation of JNK cascade	IMP	17584736
GO:0046777	Process	Protein autophosphorylation	IDA	8195146
GO:0106310	Function	Protein serine kinase activity	IEA

MIM	HGNC	e!Ensembl
600050	6850	ENSG00000173327

Q16584

Protein name

Mitogen-activated protein kinase kinase kinase 11 (EC 2.7.11.25) (Mixed lineage kinase 3) (Src-homology 3 domain-containing proline-rich kinase)

Protein function

Activates the JUN N-terminal pathway. Required for serum-stimulated cell proliferation and for mitogen and cytokine activation of MAPK14 (p38), MAPK3 (ERK) and MAPK8 (JNK1) through phosphorylation and activation of MAP2K4/MKK4 and MAP2K7/MKK7. P

PDB

5K26 , 5K28 , 6AQB , 6CQ7

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF14604	SH3_9	48 → 101	Variant SH3 domain	Domain
PF07714	PK_Tyr_Ser-Thr	117 → 376	Protein tyrosine and serine/threonine kinase	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in a wide variety of normal and neoplastic tissues including fetal lung, liver, heart and kidney, and adult lung, liver, heart, kidney, placenta, skeletal muscle, pancreas and brain. {ECO:0000269|PubMed:8183572, ECO:0000269|P

Sequence

MEPLKSLFLKSPLGSWNGSGSGGGGGGGGGRPEGSPKAAGYANPVWTALFDYEPSGQDEL
ALRKGDRVEVLSRDAAISGDEGWWAGQVGGQVGIFPSNYVSRGGGPPPCEVASFQELRLE
EVIGIGGFGKVYRGSWRGELVAVKAARQDPDEDISVTAESVRQEARLFAMLAHPNIIALK
AVCLEEPNLCLVMEYAAGGPLSRALAGRRVPPHVLVNWAVQIARGMHYLHCEALVPVIHR
DLKSNNILLLQPIESDDMEHKTLKITDFGLAREWHKTTQMSAAGTYAWMAPEVIKASTFS
KGSDVWSFGVLLWELLTGEVPYRGIDCLAVAYGVAVNKLTLPIPSTCPEPFAQLMADCWA
QDPHRRPDFASILQQLEALEAQVLREMPRDSFHSMQEGWKREIQGLFDELRAKEKELLSR
EEELTRAAREQRSQAEQLRRREHLLAQWELEVFERELTLLLQQVDRERPHVRRRRGTFKR
SKLRARDGGERISMPLDFKHRITVQASPGLDRRRNVFEVGPGDSPTFPRFRAIQLEPAEP
GQAWGRQSPRRLEDSSNGERRACWAWGPSSPKPGEAQNGRRRSRMDEATWYLDSDDSSPL
GSPSTPPALNGNPPRPSLEPEEPKRPVPAERGSSSGTPKLIQRALLRGTALLASLGLGRD
LQPPGGPGRERGESPTTPPTPTPAPCPTEPPPSPLICFSLKTPDSPPTPAPLLLDLGIPV
GQRSAKSPRREEEPRGGTVSPPPGTSRSAPGTPGTPRSPPLGLISRPRPSPLRSRIDPWS
FVSAGPRPSPLPSPQPAPRRAPWTLFPDSDPFWDSPPANPFQGGPQDCRAQTKDMGAQAP
WVPEAGP

Sequence length

847

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway Non-alcoholic fatty liver disease		RAF activation Signaling by moderate kinase activity BRAF mutants Paradoxical activation of RAF signaling by kinase inactive BRAF Signaling downstream of RAS mutants

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Moyamoya angiopathy	Likely pathogenic	rs746476599	RCV004704487	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATOPIC ECZEMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (73)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	36969166	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Gouty	Gouty arthritis	GWASCAT_DG	25646370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	28479334	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	BEFREE	22123824, 28522336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	20514022, 30664689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	15001580, 26152725, 28388540	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	19567454, 24912674	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	19955118, 21070916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32214367	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	22123824, 30412737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	22123824		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	31192472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	31192472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	26138442		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	23027623, 29084209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	24628919, 29084209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24628919, 29084209	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	30362822		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	35246263	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	28555332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	14734742		★★★★★ ★☆☆☆☆ Found in Text Mining only
Delirium, Dementia, Amnestic, Cognitive Disorders	Delirium, Dementia, Amnestic, Cognitive Disorders	BEFREE	23761895, 31654642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	30269330		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	26717044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	26717044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	26717044	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	28768902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	24628919	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	28487380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	28487380	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	28487380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gout	Gout	GWASCAT_DG	25646370		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart failure	Heart Failure	BEFREE	30362822		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Malignant Neoplasm	Hereditary cancer	BEFREE	9187672		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	30362822		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophic obstructive cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	30362822		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophy Left Ventricular	Left ventricular disease	Pubtator	29506515	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29072702		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	31654642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	30269330		★★★★★ ★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	29506515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	19567454	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31527306		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	20514022, 30664689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	26717044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	19955118, 24628919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	17707342, 21880738		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19955118, 20514022, 23627838, 30664689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	31192472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	23027623, 29084209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	20145118, 28388540		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	35307409	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE DISORDER, CHRONIC, WITH EOSINOPHILIA	Myeloproliferative Disorder with Eosinophilia	BEFREE	30985967		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21048306, 22139075, 26138442, 26717044, 28388540, 31258753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurocognitive Disorders	Neurocognitive Disorders	BEFREE	23761895, 31654642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	17711861		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	31258753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	28768902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	28479334	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	20145118, 28388540, 28604765		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	22652451, 24912674, 28757353, 33875576, 35843311	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	31077715		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	31551334		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	17707342, 21880738		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21880738, 22761715	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29072702		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	23797008	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	14734742		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	27788211		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	20150185, 21048306	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	28604765		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	32235890	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Turcot syndrome (disorder)	Turcot syndrome	BEFREE	19955118		★★★★★ ★☆☆☆☆ Found in Text Mining only

MAP3K11 (mitogen-activated protein kinase kinase kinase 11)