Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID	4288
Gene name	Marker of proliferation Ki-67
Gene symbol	MKI67
Synonyms (NCBI Gene)	KIAMIB-MIB-1PPP1R105
Chromosome	10
Chromosome location	10q26.2
Summary	This gene encodes a nuclear protein that is associated with and may be necessary for cellular proliferation. Alternatively spliced transcript variants have been described. A related pseudogene exists on chromosome X. [provided by RefSeq, Mar 2009]

478

Show/Hide all (478)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006792	hsa-miR-519d-3p	GFP reporter assayqRT-PCR	21524841
MIRT023674	hsa-miR-1-3p	Proteomics	18668040
MIRT024267	hsa-miR-215-5p	Microarray	19074876
MIRT025361	hsa-miR-34a-5p	Proteomics	21566225
MIRT026336	hsa-miR-192-5p	Microarray	19074876
MIRT031529	hsa-miR-16-5p	Proteomics	18668040
MIRT051657	hsa-let-7e-5p	CLASH	23622248
MIRT051037	hsa-miR-17-5p	CLASH	23622248
MIRT049015	hsa-miR-92a-3p	CLASH	23622248
MIRT049015	hsa-miR-92a-3p	CLASH	23622248
MIRT048383	hsa-miR-29b-3p	CLASH	23622248
MIRT046919	hsa-miR-221-3p	CLASH	23622248
MIRT046919	hsa-miR-221-3p	CLASH	23622248
MIRT046919	hsa-miR-221-3p	CLASH	23622248
MIRT043812	hsa-miR-328-3p	CLASH	23622248
MIRT043477	hsa-miR-331-3p	CLASH	23622248
MIRT041876	hsa-miR-484	CLASH	23622248
MIRT041044	hsa-miR-505-3p	CLASH	23622248
MIRT040461	hsa-miR-615-3p	CLASH	23622248
MIRT037098	hsa-miR-877-3p	CLASH	23622248
MIRT036119	hsa-miR-1296-5p	CLASH	23622248
MIRT035804	hsa-miR-1909-5p	CLASH	23622248
MIRT693221	hsa-miR-548a-5p	HITS-CLIP	23313552
MIRT693220	hsa-miR-548ab	HITS-CLIP	23313552
MIRT693219	hsa-miR-548ad-5p	HITS-CLIP	23313552
MIRT693218	hsa-miR-548ae-5p	HITS-CLIP	23313552
MIRT693217	hsa-miR-548ak	HITS-CLIP	23313552
MIRT693216	hsa-miR-548am-5p	HITS-CLIP	23313552
MIRT693215	hsa-miR-548ap-5p	HITS-CLIP	23313552
MIRT693214	hsa-miR-548aq-5p	HITS-CLIP	23313552
MIRT693213	hsa-miR-548ar-5p	HITS-CLIP	23313552
MIRT693212	hsa-miR-548as-5p	HITS-CLIP	23313552
MIRT693211	hsa-miR-548au-5p	HITS-CLIP	23313552
MIRT693210	hsa-miR-548ay-5p	HITS-CLIP	23313552
MIRT693209	hsa-miR-548b-5p	HITS-CLIP	23313552
MIRT693208	hsa-miR-548bb-5p	HITS-CLIP	23313552
MIRT693207	hsa-miR-548c-5p	HITS-CLIP	23313552
MIRT693206	hsa-miR-548d-5p	HITS-CLIP	23313552
MIRT693205	hsa-miR-548h-5p	HITS-CLIP	23313552
MIRT693204	hsa-miR-548i	HITS-CLIP	23313552
MIRT693203	hsa-miR-548j-5p	HITS-CLIP	23313552
MIRT693202	hsa-miR-548o-5p	HITS-CLIP	23313552
MIRT693201	hsa-miR-548w	HITS-CLIP	23313552
MIRT693200	hsa-miR-548y	HITS-CLIP	23313552
MIRT693199	hsa-miR-559	HITS-CLIP	23313552
MIRT693198	hsa-miR-4796-3p	HITS-CLIP	23313552
MIRT693197	hsa-miR-3646	HITS-CLIP	23313552
MIRT693196	hsa-miR-1252-3p	HITS-CLIP	23313552
MIRT693195	hsa-miR-520g-3p	HITS-CLIP	23313552
MIRT693194	hsa-miR-520h	HITS-CLIP	23313552
MIRT693193	hsa-miR-1283	HITS-CLIP	23313552
MIRT693192	hsa-miR-4699-5p	HITS-CLIP	23313552
MIRT693191	hsa-miR-3978	HITS-CLIP	23313552
MIRT693190	hsa-miR-6083	HITS-CLIP	23313552
MIRT573903	hsa-miR-4722-3p	PAR-CLIP	20371350
MIRT573902	hsa-miR-6727-3p	PAR-CLIP	20371350
MIRT573901	hsa-miR-6747-3p	PAR-CLIP	20371350
MIRT573899	hsa-miR-1185-5p	PAR-CLIP	20371350
MIRT573900	hsa-miR-3679-5p	PAR-CLIP	20371350
MIRT573898	hsa-miR-4326	PAR-CLIP	20371350
MIRT573897	hsa-miR-3074-5p	PAR-CLIP	20371350
MIRT573896	hsa-miR-1914-5p	PAR-CLIP	20371350
MIRT573895	hsa-miR-3653-5p	PAR-CLIP	20371350
MIRT573894	hsa-miR-1976	PAR-CLIP	20371350
MIRT573893	hsa-miR-619-5p	PAR-CLIP	20371350
MIRT573892	hsa-miR-6506-5p	PAR-CLIP	20371350
MIRT573891	hsa-miR-6131	PAR-CLIP	20371350
MIRT573889	hsa-miR-3652	PAR-CLIP	20371350
MIRT573890	hsa-miR-4430	PAR-CLIP	20371350
MIRT573888	hsa-miR-4505	PAR-CLIP	20371350
MIRT573887	hsa-miR-5787	PAR-CLIP	20371350
MIRT573886	hsa-miR-653-3p	PAR-CLIP	20371350
MIRT573885	hsa-miR-6842-3p	PAR-CLIP	20371350
MIRT573884	hsa-miR-5587-5p	PAR-CLIP	20371350
MIRT573883	hsa-miR-4474-3p	PAR-CLIP	20371350
MIRT512957	hsa-miR-4523	PAR-CLIP	23446348
MIRT512956	hsa-miR-33b-3p	PAR-CLIP	23446348
MIRT512955	hsa-miR-515-3p	PAR-CLIP	23446348
MIRT512954	hsa-miR-519e-3p	PAR-CLIP	23446348
MIRT512953	hsa-miR-664a-3p	PAR-CLIP	23446348
MIRT035804	hsa-miR-1909-5p	PAR-CLIP	23446348
MIRT512952	hsa-miR-4763-5p	PAR-CLIP	23446348
MIRT512951	hsa-miR-1271-3p	PAR-CLIP	23446348
MIRT512950	hsa-miR-550a-3-5p	PAR-CLIP	23446348
MIRT512949	hsa-miR-550a-5p	PAR-CLIP	23446348
MIRT512948	hsa-miR-1298-5p	PAR-CLIP	23446348
MIRT512947	hsa-miR-6894-3p	PAR-CLIP	23446348
MIRT440239	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT440239	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT693221	hsa-miR-548a-5p	HITS-CLIP	23313552
MIRT693220	hsa-miR-548ab	HITS-CLIP	23313552
MIRT693219	hsa-miR-548ad-5p	HITS-CLIP	23313552
MIRT693218	hsa-miR-548ae-5p	HITS-CLIP	23313552
MIRT693217	hsa-miR-548ak	HITS-CLIP	23313552
MIRT693216	hsa-miR-548am-5p	HITS-CLIP	23313552
MIRT693215	hsa-miR-548ap-5p	HITS-CLIP	23313552
MIRT693214	hsa-miR-548aq-5p	HITS-CLIP	23313552
MIRT693213	hsa-miR-548ar-5p	HITS-CLIP	23313552
MIRT693212	hsa-miR-548as-5p	HITS-CLIP	23313552
MIRT693211	hsa-miR-548au-5p	HITS-CLIP	23313552
MIRT693210	hsa-miR-548ay-5p	HITS-CLIP	23313552
MIRT693209	hsa-miR-548b-5p	HITS-CLIP	23313552
MIRT693208	hsa-miR-548bb-5p	HITS-CLIP	23313552
MIRT693207	hsa-miR-548c-5p	HITS-CLIP	23313552
MIRT693206	hsa-miR-548d-5p	HITS-CLIP	23313552
MIRT693205	hsa-miR-548h-5p	HITS-CLIP	23313552
MIRT693204	hsa-miR-548i	HITS-CLIP	23313552
MIRT693203	hsa-miR-548j-5p	HITS-CLIP	23313552
MIRT693202	hsa-miR-548o-5p	HITS-CLIP	23313552
MIRT693201	hsa-miR-548w	HITS-CLIP	23313552
MIRT693200	hsa-miR-548y	HITS-CLIP	23313552
MIRT693199	hsa-miR-559	HITS-CLIP	23313552
MIRT693198	hsa-miR-4796-3p	HITS-CLIP	23313552
MIRT693197	hsa-miR-3646	HITS-CLIP	23313552
MIRT693196	hsa-miR-1252-3p	HITS-CLIP	23313552
MIRT693195	hsa-miR-520g-3p	HITS-CLIP	23313552
MIRT693194	hsa-miR-520h	HITS-CLIP	23313552
MIRT693193	hsa-miR-1283	HITS-CLIP	23313552
MIRT693192	hsa-miR-4699-5p	HITS-CLIP	23313552
MIRT693191	hsa-miR-3978	HITS-CLIP	23313552
MIRT693190	hsa-miR-6083	HITS-CLIP	23313552
MIRT573903	hsa-miR-4722-3p	PAR-CLIP	20371350
MIRT573902	hsa-miR-6727-3p	PAR-CLIP	20371350
MIRT573901	hsa-miR-6747-3p	PAR-CLIP	20371350
MIRT573899	hsa-miR-1185-5p	PAR-CLIP	20371350
MIRT573900	hsa-miR-3679-5p	PAR-CLIP	20371350
MIRT573898	hsa-miR-4326	PAR-CLIP	20371350
MIRT573897	hsa-miR-3074-5p	PAR-CLIP	20371350
MIRT573896	hsa-miR-1914-5p	PAR-CLIP	20371350
MIRT573895	hsa-miR-3653-5p	PAR-CLIP	20371350
MIRT573894	hsa-miR-1976	PAR-CLIP	20371350
MIRT573893	hsa-miR-619-5p	PAR-CLIP	20371350
MIRT573892	hsa-miR-6506-5p	PAR-CLIP	20371350
MIRT573891	hsa-miR-6131	PAR-CLIP	20371350
MIRT573889	hsa-miR-3652	PAR-CLIP	20371350
MIRT573890	hsa-miR-4430	PAR-CLIP	20371350
MIRT573888	hsa-miR-4505	PAR-CLIP	20371350
MIRT573887	hsa-miR-5787	PAR-CLIP	20371350
MIRT573886	hsa-miR-653-3p	PAR-CLIP	20371350
MIRT573885	hsa-miR-6842-3p	PAR-CLIP	20371350
MIRT573884	hsa-miR-5587-5p	PAR-CLIP	20371350
MIRT573883	hsa-miR-4474-3p	PAR-CLIP	20371350
MIRT512957	hsa-miR-4523	PAR-CLIP	23446348
MIRT512956	hsa-miR-33b-3p	PAR-CLIP	23446348
MIRT512955	hsa-miR-515-3p	PAR-CLIP	23446348
MIRT512954	hsa-miR-519e-3p	PAR-CLIP	23446348
MIRT512953	hsa-miR-664a-3p	PAR-CLIP	23446348
MIRT035804	hsa-miR-1909-5p	PAR-CLIP	23446348
MIRT512952	hsa-miR-4763-5p	PAR-CLIP	23446348
MIRT512951	hsa-miR-1271-3p	PAR-CLIP	23446348
MIRT512950	hsa-miR-550a-3-5p	PAR-CLIP	23446348
MIRT512949	hsa-miR-550a-5p	PAR-CLIP	23446348
MIRT512948	hsa-miR-1298-5p	PAR-CLIP	23446348
MIRT512947	hsa-miR-6894-3p	PAR-CLIP	23446348
MIRT756470	hsa-miR-182-5p	qRT-PCR	38796528
MIRT1149591	hsa-miR-1231	CLIP-seq
MIRT1149592	hsa-miR-1254	CLIP-seq
MIRT1149593	hsa-miR-127-5p	CLIP-seq
MIRT1149594	hsa-miR-1293	CLIP-seq
MIRT1149595	hsa-miR-1298	CLIP-seq
MIRT1149596	hsa-miR-1913	CLIP-seq
MIRT1149597	hsa-miR-1914	CLIP-seq
MIRT1149598	hsa-miR-2117	CLIP-seq
MIRT1149599	hsa-miR-2276	CLIP-seq
MIRT1149600	hsa-miR-2964a-5p	CLIP-seq
MIRT1149601	hsa-miR-3116	CLIP-seq
MIRT1149602	hsa-miR-3117-3p	CLIP-seq
MIRT1149603	hsa-miR-3135	CLIP-seq
MIRT1149604	hsa-miR-3135b	CLIP-seq
MIRT1149605	hsa-miR-3169	CLIP-seq
MIRT1149606	hsa-miR-3189-5p	CLIP-seq
MIRT1149607	hsa-miR-320a	CLIP-seq
MIRT1149608	hsa-miR-320b	CLIP-seq
MIRT1149609	hsa-miR-320c	CLIP-seq
MIRT1149610	hsa-miR-320d	CLIP-seq
MIRT1149611	hsa-miR-320e	CLIP-seq
MIRT1149612	hsa-miR-323b-3p	CLIP-seq
MIRT1149613	hsa-miR-324-3p	CLIP-seq
MIRT1149614	hsa-miR-3613-3p	CLIP-seq
MIRT1149615	hsa-miR-3614-3p	CLIP-seq
MIRT1149616	hsa-miR-3622b-5p	CLIP-seq
MIRT1149617	hsa-miR-371-5p	CLIP-seq
MIRT1149618	hsa-miR-371b-5p	CLIP-seq
MIRT1149619	hsa-miR-375	CLIP-seq
MIRT1149620	hsa-miR-3913-3p	CLIP-seq
MIRT1149621	hsa-miR-3922-5p	CLIP-seq
MIRT1149622	hsa-miR-3944-5p	CLIP-seq
MIRT1149623	hsa-miR-4254	CLIP-seq
MIRT1149624	hsa-miR-4273	CLIP-seq
MIRT1149625	hsa-miR-4429	CLIP-seq
MIRT1149626	hsa-miR-4434	CLIP-seq
MIRT1149627	hsa-miR-4446-5p	CLIP-seq
MIRT1149628	hsa-miR-4459	CLIP-seq
MIRT1149629	hsa-miR-4470	CLIP-seq
MIRT1149630	hsa-miR-4483	CLIP-seq
MIRT1149631	hsa-miR-4506	CLIP-seq
MIRT1149632	hsa-miR-4511	CLIP-seq
MIRT1149633	hsa-miR-4516	CLIP-seq
MIRT1149634	hsa-miR-4531	CLIP-seq
MIRT1149635	hsa-miR-4637	CLIP-seq
MIRT1149636	hsa-miR-4645-5p	CLIP-seq
MIRT1149637	hsa-miR-4673	CLIP-seq
MIRT1149638	hsa-miR-4677-5p	CLIP-seq
MIRT1149639	hsa-miR-4742-5p	CLIP-seq
MIRT1149640	hsa-miR-4758-3p	CLIP-seq
MIRT1149641	hsa-miR-4759	CLIP-seq
MIRT1149642	hsa-miR-4762-5p	CLIP-seq
MIRT1149643	hsa-miR-4772-3p	CLIP-seq
MIRT1149644	hsa-miR-4775	CLIP-seq
MIRT1149645	hsa-miR-4779	CLIP-seq
MIRT1149646	hsa-miR-4795-3p	CLIP-seq
MIRT1149647	hsa-miR-513c	CLIP-seq
MIRT1149648	hsa-miR-514b-5p	CLIP-seq
MIRT1149649	hsa-miR-518a-5p	CLIP-seq
MIRT1149650	hsa-miR-527	CLIP-seq
MIRT1149651	hsa-miR-544	CLIP-seq
MIRT1149652	hsa-miR-548b-3p	CLIP-seq
MIRT1149653	hsa-miR-654-3p	CLIP-seq
MIRT1149654	hsa-miR-665	CLIP-seq
MIRT1149655	hsa-miR-765	CLIP-seq
MIRT1149656	hsa-miR-939	CLIP-seq
MIRT1149657	hsa-miR-105	CLIP-seq
MIRT1149592	hsa-miR-1254	CLIP-seq
MIRT1149658	hsa-miR-1272	CLIP-seq
MIRT1149659	hsa-miR-1273f	CLIP-seq
MIRT1149660	hsa-miR-1273g	CLIP-seq
MIRT1149661	hsa-miR-128	CLIP-seq
MIRT1149594	hsa-miR-1293	CLIP-seq
MIRT1149595	hsa-miR-1298	CLIP-seq
MIRT1149662	hsa-miR-1304	CLIP-seq
MIRT1149663	hsa-miR-1321	CLIP-seq
MIRT1149664	hsa-miR-1322	CLIP-seq
MIRT1149665	hsa-miR-136	CLIP-seq
MIRT1149666	hsa-miR-147	CLIP-seq
MIRT1149667	hsa-miR-149	CLIP-seq
MIRT1149668	hsa-miR-1827	CLIP-seq
MIRT1149597	hsa-miR-1914	CLIP-seq
MIRT1149669	hsa-miR-2054	CLIP-seq
MIRT1149670	hsa-miR-2110	CLIP-seq
MIRT1149671	hsa-miR-2277-3p	CLIP-seq
MIRT1149600	hsa-miR-2964a-5p	CLIP-seq
MIRT1149672	hsa-miR-31	CLIP-seq
MIRT1149601	hsa-miR-3116	CLIP-seq
MIRT1149602	hsa-miR-3117-3p	CLIP-seq
MIRT1149673	hsa-miR-3136-3p	CLIP-seq
MIRT1149674	hsa-miR-3144-5p	CLIP-seq
MIRT1149675	hsa-miR-3150a-3p	CLIP-seq
MIRT1149605	hsa-miR-3169	CLIP-seq
MIRT1149676	hsa-miR-3191	CLIP-seq
MIRT1149677	hsa-miR-323-5p	CLIP-seq
MIRT1149678	hsa-miR-3591-5p	CLIP-seq
MIRT1149679	hsa-miR-3612	CLIP-seq
MIRT1149614	hsa-miR-3613-3p	CLIP-seq
MIRT1149680	hsa-miR-3614-5p	CLIP-seq
MIRT1149681	hsa-miR-3622a-3p	CLIP-seq
MIRT1149682	hsa-miR-3622b-3p	CLIP-seq
MIRT1149616	hsa-miR-3622b-5p	CLIP-seq
MIRT1149683	hsa-miR-365	CLIP-seq
MIRT1149684	hsa-miR-3688-5p	CLIP-seq
MIRT1149685	hsa-miR-3689d	CLIP-seq
MIRT1149686	hsa-miR-3911	CLIP-seq
MIRT1149687	hsa-miR-3944-3p	CLIP-seq
MIRT1149622	hsa-miR-3944-5p	CLIP-seq
MIRT1149623	hsa-miR-4254	CLIP-seq
MIRT1149688	hsa-miR-4260	CLIP-seq
MIRT1149689	hsa-miR-4280	CLIP-seq
MIRT1149690	hsa-miR-4291	CLIP-seq
MIRT1149691	hsa-miR-4302	CLIP-seq
MIRT1149692	hsa-miR-4313	CLIP-seq
MIRT1149693	hsa-miR-4443	CLIP-seq
MIRT1149694	hsa-miR-4475	CLIP-seq
MIRT1149630	hsa-miR-4483	CLIP-seq
MIRT1149695	hsa-miR-4642	CLIP-seq
MIRT1149696	hsa-miR-4652-5p	CLIP-seq
MIRT1149697	hsa-miR-4676-5p	CLIP-seq
MIRT1149698	hsa-miR-4707-5p	CLIP-seq
MIRT1149699	hsa-miR-4722-5p	CLIP-seq
MIRT1149700	hsa-miR-4739	CLIP-seq
MIRT1149701	hsa-miR-4756-5p	CLIP-seq
MIRT1149641	hsa-miR-4759	CLIP-seq
MIRT1149702	hsa-miR-4768-3p	CLIP-seq
MIRT1149644	hsa-miR-4775	CLIP-seq
MIRT1149703	hsa-miR-4797-5p	CLIP-seq
MIRT1149704	hsa-miR-486-5p	CLIP-seq
MIRT1149705	hsa-miR-545	CLIP-seq
MIRT1149706	hsa-miR-550a	CLIP-seq
MIRT1149707	hsa-miR-575	CLIP-seq
MIRT1149708	hsa-miR-597	CLIP-seq
MIRT1149709	hsa-miR-600	CLIP-seq
MIRT1149710	hsa-miR-643	CLIP-seq
MIRT1149711	hsa-miR-644	CLIP-seq
MIRT1149712	hsa-miR-650	CLIP-seq
MIRT1149713	hsa-miR-664	CLIP-seq
MIRT1149714	hsa-miR-668	CLIP-seq
MIRT1149655	hsa-miR-765	CLIP-seq
MIRT1149715	hsa-miR-876-3p	CLIP-seq
MIRT1149716	hsa-miR-940	CLIP-seq
MIRT2042532	hsa-miR-106a	CLIP-seq
MIRT2042533	hsa-miR-106b	CLIP-seq
MIRT2042534	hsa-miR-1228	CLIP-seq
MIRT2042535	hsa-miR-1255a	CLIP-seq
MIRT2042536	hsa-miR-1255b	CLIP-seq
MIRT1149658	hsa-miR-1272	CLIP-seq
MIRT1149661	hsa-miR-128	CLIP-seq
MIRT2042537	hsa-miR-1287	CLIP-seq
MIRT2042538	hsa-miR-1290	CLIP-seq
MIRT1149594	hsa-miR-1293	CLIP-seq
MIRT1149595	hsa-miR-1298	CLIP-seq
MIRT1149664	hsa-miR-1322	CLIP-seq
MIRT2042539	hsa-miR-135a	CLIP-seq
MIRT2042540	hsa-miR-135b	CLIP-seq
MIRT2042541	hsa-miR-146b-3p	CLIP-seq
MIRT1149667	hsa-miR-149	CLIP-seq
MIRT2042542	hsa-miR-17	CLIP-seq
MIRT1149668	hsa-miR-1827	CLIP-seq
MIRT1149597	hsa-miR-1914	CLIP-seq
MIRT2042543	hsa-miR-205	CLIP-seq
MIRT2042544	hsa-miR-20a	CLIP-seq
MIRT2042545	hsa-miR-20b	CLIP-seq
MIRT1149670	hsa-miR-2110	CLIP-seq
MIRT1149598	hsa-miR-2117	CLIP-seq
MIRT2042546	hsa-miR-221	CLIP-seq
MIRT2042547	hsa-miR-222	CLIP-seq
MIRT1149671	hsa-miR-2277-3p	CLIP-seq
MIRT2042548	hsa-miR-27a	CLIP-seq
MIRT2042549	hsa-miR-27b	CLIP-seq
MIRT1149600	hsa-miR-2964a-5p	CLIP-seq
MIRT1149603	hsa-miR-3135	CLIP-seq
MIRT1149673	hsa-miR-3136-3p	CLIP-seq
MIRT1149675	hsa-miR-3150a-3p	CLIP-seq
MIRT2042550	hsa-miR-3160-3p	CLIP-seq
MIRT2042551	hsa-miR-3173-5p	CLIP-seq
MIRT2042552	hsa-miR-328	CLIP-seq
MIRT2042553	hsa-miR-342-3p	CLIP-seq
MIRT1149679	hsa-miR-3612	CLIP-seq
MIRT1149680	hsa-miR-3614-5p	CLIP-seq
MIRT1149681	hsa-miR-3622a-3p	CLIP-seq
MIRT1149682	hsa-miR-3622b-3p	CLIP-seq
MIRT1149616	hsa-miR-3622b-5p	CLIP-seq
MIRT2042554	hsa-miR-3676	CLIP-seq
MIRT2042555	hsa-miR-3692	CLIP-seq
MIRT1149617	hsa-miR-371-5p	CLIP-seq
MIRT1149618	hsa-miR-371b-5p	CLIP-seq
MIRT1149619	hsa-miR-375	CLIP-seq
MIRT2042556	hsa-miR-3937	CLIP-seq
MIRT2042557	hsa-miR-3943	CLIP-seq
MIRT1149687	hsa-miR-3944-3p	CLIP-seq
MIRT1149623	hsa-miR-4254	CLIP-seq
MIRT2042558	hsa-miR-4258	CLIP-seq
MIRT1149688	hsa-miR-4260	CLIP-seq
MIRT2042559	hsa-miR-4261	CLIP-seq
MIRT1149624	hsa-miR-4273	CLIP-seq
MIRT2042560	hsa-miR-4284	CLIP-seq
MIRT1149690	hsa-miR-4291	CLIP-seq
MIRT1149691	hsa-miR-4302	CLIP-seq
MIRT2042561	hsa-miR-4308	CLIP-seq
MIRT2042562	hsa-miR-4436b-5p	CLIP-seq
MIRT2042563	hsa-miR-4457	CLIP-seq
MIRT2042564	hsa-miR-4468	CLIP-seq
MIRT1149629	hsa-miR-4470	CLIP-seq
MIRT1149630	hsa-miR-4483	CLIP-seq
MIRT2042565	hsa-miR-4509	CLIP-seq
MIRT2042566	hsa-miR-4520a-3p	CLIP-seq
MIRT2042567	hsa-miR-4520b-3p	CLIP-seq
MIRT2042568	hsa-miR-4539	CLIP-seq
MIRT2042569	hsa-miR-4633-5p	CLIP-seq
MIRT1149695	hsa-miR-4642	CLIP-seq
MIRT1149697	hsa-miR-4676-5p	CLIP-seq
MIRT1149638	hsa-miR-4677-5p	CLIP-seq
MIRT2042570	hsa-miR-4680-5p	CLIP-seq
MIRT2042571	hsa-miR-4687-3p	CLIP-seq
MIRT2042572	hsa-miR-4715-3p	CLIP-seq
MIRT2042573	hsa-miR-4718	CLIP-seq
MIRT2042574	hsa-miR-4719	CLIP-seq
MIRT2042575	hsa-miR-4744	CLIP-seq
MIRT1149642	hsa-miR-4762-5p	CLIP-seq
MIRT1149645	hsa-miR-4779	CLIP-seq
MIRT2042576	hsa-miR-4783-3p	CLIP-seq
MIRT2042577	hsa-miR-4793-3p	CLIP-seq
MIRT2042578	hsa-miR-491-3p	CLIP-seq
MIRT2042579	hsa-miR-513b	CLIP-seq
MIRT1149647	hsa-miR-513c	CLIP-seq
MIRT1149648	hsa-miR-514b-5p	CLIP-seq
MIRT2042580	hsa-miR-519d	CLIP-seq
MIRT2042581	hsa-miR-520d-5p	CLIP-seq
MIRT2042582	hsa-miR-520g	CLIP-seq
MIRT2042583	hsa-miR-524-5p	CLIP-seq
MIRT2042584	hsa-miR-532-5p	CLIP-seq
MIRT2042585	hsa-miR-542-3p	CLIP-seq
MIRT1149705	hsa-miR-545	CLIP-seq
MIRT2042586	hsa-miR-548a-3p	CLIP-seq
MIRT2042587	hsa-miR-548ae	CLIP-seq
MIRT2042588	hsa-miR-548aj	CLIP-seq
MIRT2042589	hsa-miR-548am	CLIP-seq
MIRT2042590	hsa-miR-548e	CLIP-seq
MIRT2042591	hsa-miR-548f	CLIP-seq
MIRT2042592	hsa-miR-548h	CLIP-seq
MIRT2042593	hsa-miR-548j	CLIP-seq
MIRT2042594	hsa-miR-548v	CLIP-seq
MIRT2042595	hsa-miR-548x	CLIP-seq
MIRT2042596	hsa-miR-561	CLIP-seq
MIRT2042597	hsa-miR-570	CLIP-seq
MIRT1149707	hsa-miR-575	CLIP-seq
MIRT1149709	hsa-miR-600	CLIP-seq
MIRT2042598	hsa-miR-618	CLIP-seq
MIRT1149712	hsa-miR-650	CLIP-seq
MIRT1149713	hsa-miR-664	CLIP-seq
MIRT1149655	hsa-miR-765	CLIP-seq
MIRT2042599	hsa-miR-874	CLIP-seq
MIRT2042600	hsa-miR-885-3p	CLIP-seq
MIRT2042601	hsa-miR-93	CLIP-seq
MIRT2042532	hsa-miR-106a	CLIP-seq
MIRT2042533	hsa-miR-106b	CLIP-seq
MIRT2272178	hsa-miR-10a	CLIP-seq
MIRT2272179	hsa-miR-10b	CLIP-seq
MIRT2042534	hsa-miR-1228	CLIP-seq
MIRT1149592	hsa-miR-1254	CLIP-seq
MIRT2272180	hsa-miR-125a-5p	CLIP-seq
MIRT2272181	hsa-miR-125b	CLIP-seq
MIRT1149658	hsa-miR-1272	CLIP-seq
MIRT2272182	hsa-miR-1275	CLIP-seq
MIRT1149662	hsa-miR-1304	CLIP-seq
MIRT1149664	hsa-miR-1322	CLIP-seq
MIRT1149667	hsa-miR-149	CLIP-seq
MIRT2042542	hsa-miR-17	CLIP-seq
MIRT2272183	hsa-miR-1910	CLIP-seq
MIRT2042543	hsa-miR-205	CLIP-seq
MIRT2272184	hsa-miR-2052	CLIP-seq
MIRT2042544	hsa-miR-20a	CLIP-seq
MIRT2042545	hsa-miR-20b	CLIP-seq
MIRT1149670	hsa-miR-2110	CLIP-seq
MIRT1149600	hsa-miR-2964a-5p	CLIP-seq
MIRT1149601	hsa-miR-3116	CLIP-seq
MIRT1149673	hsa-miR-3136-3p	CLIP-seq
MIRT2042552	hsa-miR-328	CLIP-seq
MIRT2042553	hsa-miR-342-3p	CLIP-seq
MIRT1149681	hsa-miR-3622a-3p	CLIP-seq
MIRT1149682	hsa-miR-3622b-3p	CLIP-seq
MIRT1149616	hsa-miR-3622b-5p	CLIP-seq
MIRT2272185	hsa-miR-3649	CLIP-seq
MIRT1149623	hsa-miR-4254	CLIP-seq
MIRT2042558	hsa-miR-4258	CLIP-seq
MIRT1149688	hsa-miR-4260	CLIP-seq
MIRT2042559	hsa-miR-4261	CLIP-seq
MIRT2272186	hsa-miR-4264	CLIP-seq
MIRT2272187	hsa-miR-4271	CLIP-seq
MIRT1149690	hsa-miR-4291	CLIP-seq
MIRT2272188	hsa-miR-4319	CLIP-seq
MIRT2272189	hsa-miR-4324	CLIP-seq
MIRT2272190	hsa-miR-4525	CLIP-seq
MIRT2272191	hsa-miR-455-3p	CLIP-seq
MIRT2042569	hsa-miR-4633-5p	CLIP-seq
MIRT2272192	hsa-miR-4665-5p	CLIP-seq
MIRT2272193	hsa-miR-4667-5p	CLIP-seq
MIRT2272194	hsa-miR-4700-5p	CLIP-seq
MIRT2042574	hsa-miR-4719	CLIP-seq
MIRT2272195	hsa-miR-4723-5p	CLIP-seq
MIRT2272196	hsa-miR-4724-5p	CLIP-seq
MIRT2272197	hsa-miR-4725-3p	CLIP-seq
MIRT2272198	hsa-miR-4725-5p	CLIP-seq
MIRT2272199	hsa-miR-4766-5p	CLIP-seq
MIRT2272200	hsa-miR-4797-3p	CLIP-seq
MIRT2042578	hsa-miR-491-3p	CLIP-seq
MIRT2272201	hsa-miR-495	CLIP-seq
MIRT2272202	hsa-miR-504	CLIP-seq
MIRT2042579	hsa-miR-513b	CLIP-seq
MIRT2042580	hsa-miR-519d	CLIP-seq
MIRT2042582	hsa-miR-520g	CLIP-seq
MIRT2042584	hsa-miR-532-5p	CLIP-seq
MIRT2272203	hsa-miR-539	CLIP-seq
MIRT1149705	hsa-miR-545	CLIP-seq
MIRT2042596	hsa-miR-561	CLIP-seq
MIRT2272204	hsa-miR-625	CLIP-seq
MIRT2272205	hsa-miR-661	CLIP-seq
MIRT1149654	hsa-miR-665	CLIP-seq
MIRT1149655	hsa-miR-765	CLIP-seq
MIRT2042601	hsa-miR-93	CLIP-seq
MIRT2390923	hsa-miR-4670-3p	CLIP-seq

Show/Hide all (4)

Transcription factor	Regulation	Reference
PRDM1	Unknown	20530581
SATB1	Activation	22839214
SOX2	Repression	20739473
TP53	Unknown	14675138

Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000793	Component	Condensed chromosome	IDA	27362226, 28935370, 32879492, 35513709, 39153474
GO:0003677	Function	DNA binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674
GO:0003723	Function	RNA binding	IDA	28935370, 39153474
GO:0005515	Function	Protein binding	IPI	10878014, 11342549, 16244663, 17577209, 26949251
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	22378020
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005694	Component	Chromosome	IBA
GO:0005694	Component	Chromosome	IDA
GO:0005694	Component	Chromosome	IEA
GO:0005730	Component	Nucleolus	IDA	17577209
GO:0005730	Component	Nucleolus	IEA
GO:0007059	Process	Chromosome segregation	IDA	27362226, 32879492, 39153474
GO:0007088	Process	Regulation of mitotic nuclear division	IBA
GO:0007088	Process	Regulation of mitotic nuclear division	IDA	27362226
GO:0008283	Process	Cell population proliferation	ISS
GO:0008283	Process	Cell population proliferation	TAS	8227122
GO:0016020	Component	Membrane	HDA	19946888
GO:0140693	Function	Molecular condensate scaffold activity	IDA	35513709, 39153474
GO:1902275	Process	Regulation of chromatin organization	ISS

MIM	HGNC	e!Ensembl
176741	7107	ENSG00000148773

P46013

Protein name

Proliferation marker protein Ki-67 (Antigen identified by monoclonal antibody Ki-67) (Antigen KI-67) (Antigen Ki67)

Protein function

Protein that associates with the surface of mitotic chromosomes and acts both as a chromosome repellent during early mitosis and chromosome attractant during late mitosis (PubMed:27362226, PubMed:32879492, PubMed:35513709, PubMed:39153474). Requ

PDB

1R21 , 2AFF , 5J28

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00498	FHA	27 → 91	FHA domain	Family
PF15276	PP1_bind	502 → 561	Protein phosphatase 1 binding	Family
PF08065	KI67R	1001 → 1112	KI67R (NUC007) repeat	Repeat
PF08065	KI67R	1123 → 1234	KI67R (NUC007) repeat	Repeat
PF08065	KI67R	1245 → 1356	KI67R (NUC007) repeat	Repeat
PF08065	KI67R	1367 → 1477	KI67R (NUC007) repeat	Repeat
PF08065	KI67R	1488 → 1597	KI67R (NUC007) repeat	Repeat
PF08065	KI67R	1609 → 1720	KI67R (NUC007) repeat	Repeat
PF08065	KI67R	1731 → 1842	KI67R (NUC007) repeat	Repeat
PF08065	KI67R	1852 → 1964	KI67R (NUC007) repeat	Repeat
PF08065	KI67R	1975 → 2086	KI67R (NUC007) repeat	Repeat
PF08065	KI67R	2097 → 2204	KI67R (NUC007) repeat	Repeat
PF08065	KI67R	2215 → 2326	KI67R (NUC007) repeat	Repeat
PF08065	KI67R	2336 → 2447	KI67R (NUC007) repeat	Repeat
PF08065	KI67R	2458 → 2569	KI67R (NUC007) repeat	Repeat
PF08065	KI67R	2580 → 2688	KI67R (NUC007) repeat	Repeat
PF08065	KI67R	2700 → 2806	KI67R (NUC007) repeat	Repeat
PF08065	KI67R	2819 → 2928	KI67R (NUC007) repeat	Repeat

Sequence

MWPTRRLVTIKRSGVDGPHFPLSLSTCLFGRGIECDIRIQLPVVSKQHCKIEIHEQEAIL
HNFSSTNPTQVNGSVIDEPVRLKHGDVITIIDRSFRYENESLQNGRKSTEFPRKIREQEP
ARRVSRSSFSSDPDEKAQDSKAYSKITEGKVSGNPQVHIKNVKEDSTADDSKDSVAQGTT
NVHSSEHAGRNGRNAADPISGDFKEISSVKLVSRYGELKSVPTTQCLDNSKKNESPFWKL
YESVKKELDVKSQKENVLQYCRKSGLQTDYATEKESADGLQGETQLLVSRKSRPKSGGSG
HAVAEPASPEQELDQNKGKGRDVESVQTPSKAVGASFPLYEPAKMKTPVQYSQQQNSPQK
HKNKDLYTTGRRESVNLGKSEGFKAGDKTLTPRKLSTRNRTPAKVEDAADSATKPENLSS
KTRGSIPTDVEVLPTETEIHNEPFLTLWLTQVERKIQKDSLSKPEKLGTTAGQMCSGLPG
LSSVDINNFGDSINESEGIPLKRRRVSFGGHLRPELFDENLPPNTPLKRGEAPTKRKSLV
MHTPPVLKKIIKEQPQPSGKQESGSEIHVEVKAQSLVISPPAPSPRKTPVASDQRRRSCK
TAPASSSKSQTEVPKRGGRKSGNLPSKRVSISRSQHDILQMICSKRRSGASEANLIVAKS
WADVVKLGAKQTQTKVIKHGPQRSMNKRQRRPATPKKPVGEVHSQFSTGHANSPCTIIIG
KAHTEKVHVPARPYRVLNNFISNQKMDFKEDLSGIAEMFKTPVKEQPQLTSTCHIAISNS
ENLLGKQFQGTDSGEEPLLPTSESFGGNVFFSAQNAAKQPSDKCSASPPLRRQCIRENGN
VAKTPRNTYKMTSLETKTSDTETEPSKTVSTANRSGRSTEFRNIQKLPVESKSEETNTEI
VECILKRGQKATLLQQRREGEMKEIERPFETYKENIELKENDEKMKAMKRSRTWGQKCAP
MSDLTDLKSLPDTELMKDTARGQNLLQTQDHAKAPKSEKGKITKMPCQSLQPEPINTPTH
TKQQLKASLGKVGVKEELLAVGKFTRTSGETTHTHREPAGDGKSIRTFKESPKQILDPAA
RVTGMKKWPRTPKEEAQSLEDLAGFKELFQTPGPSEESMTDEKTTKIACKSPPPESVDTP
TSTKQWPKRSLRKADVEEEFLALRKLTPSAGKAMLTPKPAGGDEKDIKAFMGTPVQKLDL
AGTLPGSKRQLQTPKEKAQALEDLAGFKELFQTPGHTEELVAAGKTTKIPCDSPQSDPVD
TPTSTKQRPKRSIRKADVEGELLACRNLMPSAGKAMHTPKPSVGEEKDIIIFVGTPVQKL
DLTENLTGSKRRPQTPKEEAQALEDLTGFKELFQTPGHTEEAVAAGKTTKMPCESSPPES
ADTPTSTRRQPKTPLEKRDVQKELSALKKLTQTSGETTHTDKVPGGEDKSINAFRETAKQ
KLDPAASVTGSKRHPKTKEKAQPLEDLAGLKELFQTPVCTDKPTTHEKTTKIACRSQPDP
VDTPTSSKPQSKRSLRKVDVEEEFFALRKRTPSAGKAMHTPKPAVSGEKNIYAFMGTPVQ
KLDLTENLTGSKRRLQTPKEKAQALEDLAGFKELFQTRGHTEESMTNDKTAKVACKSSQP
DPDKNPASSKRRLKTSLGKVGVKEELLAVGKLTQTSGETTHTHTEPTGDGKSMKAFMESP
KQILDSAASLTGSKRQLRTPKGKSEVPEDLAGFIELFQTPSHTKESMTNEKTTKVSYRAS
QPDLVDTPTSSKPQPKRSLRKADTEEEFLAFRKQTPSAGKAMHTPKPAVGEEKDINTFLG
TPVQKLDQPGNLPGSNRRLQTRKEKAQALEELTGFRELFQTPCTDNPTTDEKTTKKILCK
SPQSDPADTPTNTKQRPKRSLKKADVEEEFLAFRKLTPSAGKAMHTPKAAVGEEKDINTF
VGTPVEKLDLLGNLPGSKRRPQTPKEKAKALEDLAGFKELFQTPGHTEESMTDDKITEVS
CKSPQPDPVKTPTSSKQRLKISLGKVGVKEEVLPVGKLTQTSGKTTQTHRETAGDGKSIK
AFKESAKQMLDPANYGTGMERWPRTPKEEAQSLEDLAGFKELFQTPDHTEESTTDDKTTK
IACKSPPPESMDTPTSTRRRPKTPLGKRDIVEELSALKQLTQTTHTDKVPGDEDKGINVF
RETAKQKLDPAASVTGSKRQPRTPKGKAQPLEDLAGLKELFQTPICTDKPTTHEKTTKIA
CRSPQPDPVGTPTIFKPQSKRSLRKADVEEESLALRKRTPSVGKAMDTPKPAGGDEKDMK
AFMGTPVQKLDLPGNLPGSKRWPQTPKEKAQALEDLAGFKELFQTPGTDKPTTDEKTTKI
ACKSPQPDPVDTPASTKQRPKRNLRKADVEEEFLALRKRTPSAGKAMDTPKPAVSDEKNI
NTFVETPVQKLDLLGNLPGSKRQPQTPKEKAEALEDLVGFKELFQTPGHTEESMTDDKIT
EVSCKSPQPESFKTSRSSKQRLKIPLVKVDMKEEPLAVSKLTRTSGETTQTHTEPTGDSK
SIKAFKESPKQILDPAASVTGSRRQLRTRKEKARALEDLVDFKELFSAPGHTEESMTIDK
NTKIPCKSPPPELTDTATSTKRCPKTRPRKEVKEELSAVERLTQTSGQSTHTHKEPASGD
EGIKVLKQRAKKKPNPVEEEPSRRRPRAPKEKAQPLEDLAGFTELSETSGHTQESLTAGK
ATKIPCESPPLEVVDTTASTKRHLRTRVQKVQVKEEPSAVKFTQTSGETTDADKEPAGED
KGIKALKESAKQTPAPAASVTGSRRRPRAPRESAQAIEDLAGFKDPAAGHTEESMTDDKT
TKIPCKSSPELEDTATSSKRRPRTRAQKVEVKEELLAVGKLTQTSGETTHTDKEPVGEGK
GTKAFKQPAKRKLDAEDVIGSRRQPRAPKEKAQPLEDLASFQELSQTPGHTEELANGAAD
SFTSAPKQTPDSGKPLKISRRVLRAPKVEPVGDVVSTRDPVKSQSKSNTSLPPLPFKRGG
GKDGSVTGTKRLRCMPAPEEIVEELPASKKQRVAPRARGKSSEPVVIMKRSLRTSAKRIE
PAEELNSNDMKTNKEEHKLQDSVPENKGISLRSRRQNKTEAEQQITEVFVLAERIEINRN
EKKPMKTSPEMDIQNPDDGARKPIPRDKVTENKRCLRSARQNESSQPKVAEESGGQKSAK
VLMQNQKGKGEAGNSDSMCLRSRKTKSQPAASTLESKSVQRVTRSVKRCAENPKKAEDNV
CVKKIRTRSHRDSEDI

Sequence length

3256

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (27)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHONDROSARCOMA, MESENCHYMAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COPPER-OVERLOAD CIRRHOSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHNS DISEASE OF LARGE BOWEL	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Likely benign; Benign; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRAFT-VS-HOST DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS, CHRONIC	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Long QT syndrome	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MKI67-related disorder	Uncertain significance; Likely benign; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-NEOPLASTIC PERIPHERAL NERVOUS SYSTEM DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL NERVOUS SYSTEM DISEASES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL NEUROPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (256)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acoustic Neuroma	Acoustic Neuroma	BEFREE	30240870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acromegaly	Acromegaly	BEFREE	25238988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Actinic keratosis	Actinic keratosis	BEFREE	18360114		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adamantinous Craniopharyngioma	Adamantinous Craniopharyngioma	BEFREE	30074466		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	11306742, 11781519, 15809747, 23594232, 29956011, 31319967, 9583887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	12647790, 15638357, 15809747		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	CTD_human_DG	19028472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	19949890, 30013444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	9583887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of rectum	Adenocarcinoma Of Rectum	BEFREE	12885834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Basal Cell	Adenocarcinoma	CTD_human_DG	19028472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Endometrioid	Endometrial Cancer	BEFREE	22766790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Oxyphilic	Adenocarcinoma	CTD_human_DG	19028472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Tubular	Adenocarcinoma	CTD_human_DG	19028472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	11416238, 11761722, 12111504, 17381350, 21753697, 25979255, 27490759, 27734275, 30214616, 9532003, 9918211		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	10414492, 22395475, 27490759, 29956755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	10526289, 15167935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	12966346		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Oligodendroglioma	Oligodendroglioma	BEFREE	14508834, 19118062		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alport Syndrome	Alport Syndrome	BEFREE	8225325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	BEFREE	12165448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	18797459		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	BEFREE	10720205, 10741908, 15937645, 16998593, 9042164, 9605755, 9839169		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic Oligodendroglioma	Anaplastic Oligodendroglioma	BEFREE	10547558, 10720205		★★★★★ ★☆☆☆☆ Found in Text Mining only
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	BEFREE	16327433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	34768991	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	15086350		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	10359140, 10720205, 11550306, 16998593, 17390041, 19937366, 9042164, 9650754, 9839169		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	28195197	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	19167444, 21084121		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	19535347, 19675454, 28984304, 29710456		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	LHGDN	18665038		★★★★★ ★☆☆☆☆ Found in Text Mining only
Basal Cell Nevus Syndrome	Basal Cell Neoplasm	BEFREE	16475695		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	11053265, 12492815		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Meningioma	Benign Meningioma	BEFREE	22137483, 27841196		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	10526289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	12210488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	20646825		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	14567610, 7582248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10623664, 12491499, 12932384, 15550862, 26285644, 27220750, 28045625, 28490348, 29858579, 30120700, 31572543, 7577754, 7705708, 8608982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	15706428, 18768436, 19436038		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	27220750, 27389414, 28045625, 28051275, 28490348, 29858579, 30097312, 30342538, 31947762, 34050358, 34146382, 34371382, 34408238, 37759508, 39663527	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	12118116		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	24098334	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10684699, 10937049, 17413981, 19151662, 23594232, 27490759, 9038733, 9918211		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	22912812, 28700999, 34724892	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of ampulla of Vater	Ampullary Carcinoma	BEFREE	10203085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	20646825		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	17459280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of Male Breast	Breast Carcinoma, male	BEFREE	8698311		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	33504936, 39714755	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Cribriform	Carcinoma	CTD_human_DG	19028472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Granular Cell	Carcinoma	CTD_human_DG	19028472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	10542942, 17413981, 23594232, 9425325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinosarcoma	LHGDN	17490723		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	20424617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	21378598	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	17260227		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	12409727, 8979100, 9422986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	LHGDN	18561741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	15104289, 17260227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Oligodendroglioma	Oligodendroglioma	BEFREE	14508834, 19118062		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	31545466, 32040444	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	12021923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	LHGDN	18095132		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	LHGDN	16295759		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	26837762, 8850247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	CTD_human_DG	19028472		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	12645814		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	12786892, 22990545, 30226594, 30557404		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	12645814		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	18005189		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24022192, 35562738, 38134110, 39739032	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	30499618, 30557404		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	18060363, 19533187, 22246337, 8990141, 9785589, 9879462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital diaphragmatic hernia	Congenital diaphragmatic hernia	BEFREE	30792093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	12429795, 16183495, 29200888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Copper-Overload Cirrhosis	Copper-Overload Cirrhosis	CTD_human_DG	22879914		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cutaneous Melanoma	Melanoma	BEFREE	16331607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	28927045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatofibrosarcoma Protuberans	Dermatofibrosarcoma Protuberans	BEFREE	10504551, 12502925		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	12118116, 28927145, 31169238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	9142183		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	30442459		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	16293976		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	35303800	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ependymoma	Ependymoma	BEFREE	20184588, 28548702, 29354850, 31489574		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	29272372		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	LHGDN	11925591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	29272372		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	11337374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	8333481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	10597921, 8990141		★★★★★ ★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	22331172		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	12152168, 17914946		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gemistocytic astrocytoma	Gemistocytic Astrocytoma	BEFREE	16614946		★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Fibroblastoma	Giant Cell Fibroblastoma	BEFREE	10504551, 12502925		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	10504534, 10720205, 10741908, 11290570, 14642363, 15235729, 15937645, 16998593, 17390041, 19937366, 27553586, 29262608, 9042164, 9839169		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	10504534, 14609169, 14642363, 15859633, 15937645, 17390041, 18981259, 19937366, 27553586, 9042164, 9839169		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	15937645, 19118062, 30655743		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	32597148	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head And Neck Neoplasms	LHGDN	11857304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangioblastoma	Hemangioblastoma	BEFREE	10592114, 11310918, 9413283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	BEFREE	29594352		★★★★★ ★☆☆☆☆ Found in Text Mining only
Histiocytoma, Benign Fibrous	Benign fibrous histiocytoma	BEFREE	7850711		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	12966346, 9234572		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	37481543	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	15891996		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	36446526	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Myofibroblastic Tumor	Inflammatory Myofibroblastic Tumor	BEFREE	16538442		★★★★★ ★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	20424617, 28927045, 29858579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	LHGDN	15964376		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	23121609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	LHGDN	18690204		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	17459280		★★★★★ ★☆☆☆☆ Found in Text Mining only
LATERAL MENINGOCELE SYNDROME	Lateral Meningocele Syndrome	BEFREE	8601525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	32425177	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	38085150	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	12931554		★★★★★ ★☆☆☆☆ Found in Text Mining only
LIMB-MAMMARY SYNDROME	Limb-Mammary Syndrome	BEFREE	8601525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liposarcoma, well differentiated	liposarcoma	BEFREE	12204056, 25550570		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12378598, 20198302, 21524841, 22912812, 27863477, 28700999, 29692627, 8838363, 9772294		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	16255765, 16629645		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	38302188	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	15104289, 18727426		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	35178291	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	28927045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	30467824		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	32436191	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	17296567, 28984304, 8838329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	LHGDN	17296585		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	24898903, 9655306		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Fibrous Histiocytoma	Malignant Histiocytoma	LHGDN	11759064		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Fibrous Histiocytoma	Malignant Histiocytoma	BEFREE	12204056, 15154665, 16538442, 7850711		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	LHGDN	18077791		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10504548, 15550862, 23504136, 26285644, 27220750, 28045625, 28490348, 29858579, 30120700, 31572543, 8608982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	15706428, 18768436, 19436038		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	29272372		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	29692627, 29963171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	10542942, 17413981, 23594232, 9425325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	CTD_human_DG	21442130		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	14599612		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	10325496, 11023533, 19755982, 21062978, 31697718		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	21687951, 31632479		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	28740401		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	20646825		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10526289, 10568811, 11487260, 15043466, 16998593, 17381350, 17459280, 18707725, 22395475, 26038827, 27220750, 27863477, 28283655, 29200888, 29272372 View all (7 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	17260227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	CTD_human_DG	19028472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	15706428, 18768436, 19436038		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	11839580, 14674120, 15591788, 16171567, 17065089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	15706428, 18768436, 19436038		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	18789487, 27389414		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	15706428, 18768436, 19436038		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	12015740, 8600797		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	15638382		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	16331607, 7675773, 8639055, 9194578, 9722729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	10071687, 10845390, 10850863, 11826364, 11857311, 16040297, 17937814, 18060363, 18980792, 20054806, 23250387, 23525949, 24398011, 25237942, 27375146 View all (7 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	LHGDN	15679862, 18018472, 18374497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	37880655	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	28927045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesenchymal Chondrosarcoma	Mesenchymal Chondrosarcoma	CTD_human_DG	12817616		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	LHGDN	18038314		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	9194578		★★★★★ ★☆☆☆☆ Found in Text Mining only
mixed gliomas	Glioma	BEFREE	14508834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mixed Oligodendroglioma-Astrocytoma	Mixed Oligodendroglioma-Astrocytoma	BEFREE	17390041, 19118062		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	11697492, 9655306		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucositis	Mucositis	Pubtator	21378598	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	37898408	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10063240, 10070897, 10071687, 10091748, 10203085, 10335948, 10397330, 10419598, 10623664, 10824926, 10897109, 10944127, 11102893, 11197119, 11371029 View all (121 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	11371029		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	BEFREE	12047763, 27306258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	40229714	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	20381114, 28521422		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 2	Neurofibromatosis	BEFREE	10850863		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	15255999	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	23228962, 24975429, 27590858, 30709424		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nongerminomatous Germ Cell Tumor	Nongerminomatous Tumor	BEFREE	9224380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	11678802, 20424617, 29858579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oculocutaneous albinism type 2	Oculocutaneous albinism	Pubtator	34146382	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	28045625		★★★★★ ★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	BEFREE	14508834, 17390041, 19118062, 24949947, 29489901		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	12181274, 29268950, 9661919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	LHGDN	12479099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	17413981, 9425325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Fibromata	Ovarian fibromata	BEFREE	8990141		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	10542942, 23594232		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	17377809, 17885492		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	CTD_human_DG	21442130		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	14599612		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	33804148	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary Meningioma	Papillary Meningioma	BEFREE	10845390		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	31579073		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	11781519, 9422321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	BEFREE	11197119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parathyroid Adenoma	Parathyroid Adenoma	BEFREE	22395475, 27490759		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parathyroid Gland Adenocarcinoma	Parathyroid Gland Adenocarcinoma	BEFREE	27490759		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parathyroid Neoplasms	Parathyroid Neoplasms	BEFREE	9841766		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	CTD_human_DG	20864405		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Peritoneal Fibrosis	Peritoneal fibrosis	Pubtator	37335673	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Persistent Hyperplastic Primary Vitreous	Persistent Hyperplastic Primary Vitreous	BEFREE	31462148		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	10526289, 15167935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pilocytic Astrocytoma	Astrocytoma	BEFREE	9839169		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Adenoma	Pituitary adenoma	BEFREE	21453398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	35393909	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prolactinoma	Prolactinoma	BEFREE	17287403		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10325496, 11023533, 19755982, 21062978, 31697718		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	10881734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	15217948, 16097446, 18312749		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	15788644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21629784, 33630978, 36834602, 38052806	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	CTD_human_DG	10384915		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	BEFREE	11053911, 18360114		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pustulosis of Palms and Soles	Palmoplantar Pustules	CTD_human_DG	10384915		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	12885834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Neoplasms	Rectal Neoplasms	LHGDN	17805549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	12429795, 16183495, 29200888, 8630959, 9413283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	17594714		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	15203749, 20959668		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	35523772	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor	Rhabdoid Tumor	BEFREE	16557275		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	25086956		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma 1	Rhabdomyosarcoma	BEFREE	9891539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	11165717, 12455817		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	9891539		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma, Epithelioid	Sarcoma	BEFREE	16557275		★★★★★ ★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	31545448	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	23867449		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	40229714	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	LHGDN	16479062		★★★★★ ★☆☆☆☆ Found in Text Mining only
Solitary fibrous tumor	Solitary fibrous tumor	BEFREE	29246159		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylarthritis	Spondyloarthritis	BEFREE	16720212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	11277421, 16211276, 16328355, 25035383, 26156885, 30655856, 8879297, 9038733		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	17310847, 17647192, 17695500, 18331287, 18561741, 18766188, 18949744		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	15132777, 29272372		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	36596059	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	15891996		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	31632479		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	12434121		★★★★★ ★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	12533839, 19602458		★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	LHGDN	17693651, 18778369		★★★★★ ★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	12607601		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	28740401		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	17188136		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	28740401		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	35528004	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	22489698, 29616097		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	25068292, 39206896	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	34146382	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	10649258, 24702909, 27530957, 30446441		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	35008799	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervicitis	Uterine Cervicitis	BEFREE	11781519		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	8333481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Von Hippel-Lindau Syndrome	Von Hippel-Lindau Syndrome	BEFREE	10592114, 11310918		★★★★★ ★☆☆☆☆ Found in Text Mining only
Well Differentiated Oligodendroglioma	Oligodendroglioma	BEFREE	14508834, 17390041, 19118062, 24949947, 29489901		★★★★★ ★☆☆☆☆ Found in Text Mining only

MKI67 (marker of proliferation Ki-67)