CXCL9 (C-X-C motif chemokine ligand 9)

Gene

• Entrez ID: 4283
• Gene name: C-X-C motif chemokine ligand 9
• Gene symbol: CXCL9
• Synonyms (NCBI Gene): CMK, Humig, MIG, SCYB9, crg-10
• Chromosome: 4
• Chromosome location: 4q21.1
• Summary: This antimicrobial gene is part of a chemokine superfamily that encodes secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded is thought to be involved in T cell trafficking. The encoded protein binds to C-X-C moti

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT016944	hsa-miR-335-5p	Microarray	18185580
MIRT025283	hsa-miR-34a-5p	Proteomics	21566225
MIRT028888	hsa-miR-26b-5p	Microarray	19088304
MIRT736789	hsa-miR-588	Western blotting, Immunohistochemistry (IHC), qRT-PCR	33323542
MIRT918121	hsa-miR-1251	CLIP-seq
MIRT918122	hsa-miR-1252	CLIP-seq
MIRT918123	hsa-miR-1270	CLIP-seq
MIRT918124	hsa-miR-1278	CLIP-seq
MIRT918125	hsa-miR-1293	CLIP-seq
MIRT918126	hsa-miR-1321	CLIP-seq
MIRT918127	hsa-miR-185	CLIP-seq
MIRT918128	hsa-miR-3162-5p	CLIP-seq
MIRT918129	hsa-miR-3529	CLIP-seq
MIRT918130	hsa-miR-379	CLIP-seq
MIRT918131	hsa-miR-412	CLIP-seq
MIRT918132	hsa-miR-4272	CLIP-seq
MIRT918133	hsa-miR-4306	CLIP-seq
MIRT918134	hsa-miR-4451	CLIP-seq
MIRT918135	hsa-miR-4456	CLIP-seq
MIRT918136	hsa-miR-4483	CLIP-seq
MIRT918137	hsa-miR-4531	CLIP-seq
MIRT918138	hsa-miR-4536	CLIP-seq
MIRT918139	hsa-miR-4644	CLIP-seq
MIRT918140	hsa-miR-4650-3p	CLIP-seq
MIRT918141	hsa-miR-4666-5p	CLIP-seq
MIRT918142	hsa-miR-4670-3p	CLIP-seq
MIRT918143	hsa-miR-4739	CLIP-seq
MIRT918144	hsa-miR-4756-5p	CLIP-seq
MIRT918145	hsa-miR-541	CLIP-seq
MIRT918146	hsa-miR-582-3p	CLIP-seq
MIRT918147	hsa-miR-620	CLIP-seq
MIRT918148	hsa-miR-654-5p	CLIP-seq
MIRT1972134	hsa-miR-4434	CLIP-seq
MIRT1972135	hsa-miR-4516	CLIP-seq
MIRT918137	hsa-miR-4531	CLIP-seq
MIRT2207943	hsa-miR-135a	CLIP-seq
MIRT2207944	hsa-miR-135b	CLIP-seq
MIRT2207945	hsa-miR-4433	CLIP-seq
MIRT2207946	hsa-miR-4481	CLIP-seq
MIRT2207947	hsa-miR-4701-5p	CLIP-seq
MIRT2207948	hsa-miR-4717-3p	CLIP-seq
MIRT2207949	hsa-miR-4724-5p	CLIP-seq
MIRT2207950	hsa-miR-4745-5p	CLIP-seq
MIRT2207951	hsa-miR-4758-5p	CLIP-seq
MIRT2207952	hsa-miR-494	CLIP-seq
MIRT2386611	hsa-miR-4793-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005125	Function	Cytokine activity	IEA
GO:0005125	Function	Cytokine activity	TAS	2115167
GO:0005515	Function	Protein binding	IPI	18275857, 21314817, 25416956, 28381538, 31515488, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	TAS	8476424
GO:0006935	Process	Chemotaxis	IDA	12782716
GO:0006935	Process	Chemotaxis	IEA
GO:0006935	Process	Chemotaxis	TAS	10903763
GO:0006952	Process	Defense response	IEA
GO:0006952	Process	Defense response	TAS	2115167
GO:0006954	Process	Inflammatory response	IBA
GO:0006954	Process	Inflammatory response	IEA
GO:0006954	Process	Inflammatory response	TAS	10903763
GO:0006955	Process	Immune response	IEA
GO:0006968	Process	Cellular defense response	TAS	10570316
GO:0007165	Process	Signal transduction	TAS	10201891, 10201901
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	10903763
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	12782716
GO:0007267	Process	Cell-cell signaling	TAS	8476424
GO:0008009	Function	Chemokine activity	IBA
GO:0008009	Function	Chemokine activity	IDA	12782716
GO:0008009	Function	Chemokine activity	IEA
GO:0008009	Function	Chemokine activity	TAS	10903763
GO:0009617	Process	Response to bacterium	IEA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0030593	Process	Neutrophil chemotaxis	IBA
GO:0031640	Process	Killing of cells of another organism	IDA	12949249
GO:0042127	Process	Regulation of cell population proliferation	IDA	12782716
GO:0045236	Function	CXCR chemokine receptor binding	IBA
GO:0045663	Process	Positive regulation of myoblast differentiation	IEA
GO:0048248	Function	CXCR3 chemokine receptor binding	IDA	12782716
GO:0051281	Process	Positive regulation of release of sequestered calcium ion into cytosol	IDA	12782716
GO:0051607	Process	Defense response to virus	IEA
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	12949249
GO:0070098	Process	Chemokine-mediated signaling pathway	IBA
GO:0071222	Process	Cellular response to lipopolysaccharide	IBA
GO:1901741	Process	Positive regulation of myoblast fusion	IEA

Other IDs

• MIM: 601704
• HGNC: 7098
• e!Ensembl: ENSG00000138755

Protein

• UniProt ID: Q07325
• Protein name: C-X-C motif chemokine 9 (Gamma-interferon-induced monokine) (Monokine induced by interferon-gamma) (HuMIG) (MIG) (Small-inducible cytokine B9)
• Protein function: Cytokine that affects the growth, movement, or activation state of cells that participate in immune and inflammatory response. Chemotactic for activated T-cells. Binds to CXCR3.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00048	IL8	29 → 89	Small cytokines (intecrine/chemokine), interleukin-8 like	Domain

• Sequence:

  MKKSGVLFLLGIILLVLIGVQGTPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEK
  IEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSR
  QKKTT

• Sequence length: 125

Pathways

KEGG:

Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Chemokine signaling pathway
Toll-like receptor signaling pathway

Reactome:

Chemokine receptors bind chemokines
G alpha (i) signalling events

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BILIARY CIRRHOSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CAROTID STENOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CELIAC DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CYSTITIS, INTERSTITIAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERSENSITIVITY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTERSTITIAL CYSTITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, BILIARY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MESOTHELIOMA, MALIGNANT	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY BILIARY CHOLANGITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	17156408		★☆☆☆☆ Found in Text Mining only
Acute Megakaryocytic Leukemias	Megakaryocytic Leukemia	BEFREE	1549353, 16843266, 17156408		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	28143565		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	30130730		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	30157273		★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	BEFREE	28753101		★☆☆☆☆ Found in Text Mining only
Alloimmunisation	Alloimmunisation	BEFREE	28717357		★☆☆☆☆ Found in Text Mining only
Alopecia Areata	Alopecia Areata	CTD_human_DG	22358057		★☆☆☆☆ Found in Text Mining only
Aneurysm	Aneurysm	Pubtator	23887838	Associate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	30685120		★☆☆☆☆ Found in Text Mining only
Appendicitis	Appendicitis	BEFREE	30918467		★☆☆☆☆ Found in Text Mining only
Appendicitis	Appendicitis	Pubtator	30918467	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	26169727		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	16847431	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	17265155, 29733455		★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	11310827, 16847431	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	11178128, 15996201, 20604932, 21255008, 22401175, 26367725, 28148302, 33387686, 37573587	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	12932287, 16847431	Stimulate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	25312760, 31550242		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	31391224, 38253462	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	17991878	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	26169727		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	34128902	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	30320116		★☆☆☆☆ Found in Text Mining only
Autoimmune thyroiditis	Autoimmune Thyroiditis	BEFREE	31813786		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	15959530		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	17056573	Stimulate	★☆☆☆☆ Found in Text Mining only
Berylliosis	Berylliosis	Pubtator	34399367	Associate	★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	24894780	Associate	★☆☆☆☆ Found in Text Mining only
Biliary cirrhosis	Biliary cirrhosis	LHGDN	16243485		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Biliary cirrhosis	Biliary cirrhosis	CTD_human_DG	18422935		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Biliary Cirrhosis, Primary, 1	Biliary cirrhosis	CTD_human_DG	18422935		★☆☆☆☆ Found in Text Mining only
Blister	Blister	Pubtator	29932457	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	18925433		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	20068563, 22333315, 29495008, 31699671		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20068563, 22333315, 23981902, 29495008, 30451357, 30579865, 35052427, 35120331, 35725915, 35819135, 36766731, 40482645	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchiolitis Obliterans	Bronchiolitis Obliterans	BEFREE	16709871		★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	20228225	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	15633209, 36938723	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34085699, 37995395, 39675785	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29721380		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	15578685, 16863511, 26910919	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	37006314	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	18770863		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	29721385		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	35618744	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Restrictive	Restrictive cardiomyopathy	Pubtator	30289917	Stimulate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	35977003	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	36693381	Stimulate	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	CTD_human_DG	26564003		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Celiac Disease	Celiac disease	CTD_human_DG	30097691		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Central visual impairment	Central Visual Impairment	BEFREE	29439934		★☆☆☆☆ Found in Text Mining only
Chagas Cardiomyopathy	Chagas Cardiomyopathy	BEFREE	23150742		★☆☆☆☆ Found in Text Mining only
Chagas Cardiomyopathy	Chagas cardiomyopathy	Pubtator	23150742	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	31799781		★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	23012327	Stimulate	★☆☆☆☆ Found in Text Mining only
Chronic interstitial cystitis	Interstitial Cystitis	CTD_human_DG	18957084		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	26522085		★☆☆☆☆ Found in Text Mining only
Chronic Q Fever	Q Fever	BEFREE	28793883		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	21229279		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	29969845		★☆☆☆☆ Found in Text Mining only
Colitis Collagenous	Collagenous colitis	Pubtator	25948880	Stimulate	★☆☆☆☆ Found in Text Mining only
Colitis Collagenous	Collagenous colitis	Pubtator	33930606	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	34298022	Stimulate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	36576886, 37055495	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	24438206	Stimulate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	34233297, 36246978	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	26898419, 29456737		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	30973890, 34162701, 34233297, 34539647, 35213358	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	31775909		★☆☆☆☆ Found in Text Mining only
Common Carotid Artery Stenosis	Common Carotid Artery Stenosis	CTD_human_DG	26564003		★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	24124595		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	30779709		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	15126779, 19095263		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	28100872		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	21889313	Stimulate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	28100872		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	30333306	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	35345521	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	28100872		★☆☆☆☆ Found in Text Mining only
Coronary Stenosis	Coronary stenosis	Pubtator	35345521	Associate	★☆☆☆☆ Found in Text Mining only
Critical Illness	Critical illness	Pubtator	33780352	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	17892861		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	LHGDN	17892861		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	34106269, 36792688	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	36384659	Inhibit	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	25115612	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	34721395	Stimulate	★☆☆☆☆ Found in Text Mining only
Cystitis	Cystitis	BEFREE	30905425		★☆☆☆☆ Found in Text Mining only
Cystitis	Cystitis	Pubtator	30905425	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	17265155, 25955863		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	28821884, 30685456, 31855303, 39332980	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	33975024	Stimulate	★☆☆☆☆ Found in Text Mining only
Dermatitis Contact	Contact dermatitis	Pubtator	37187734	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	LHGDN	15113590		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	17703176		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	27892610		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	33305541	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	27325565		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	31783860	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	22385239, 28427244	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	27325565		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	29513874	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	28427244	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	33742062	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	19410617		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	25865428, 29253517		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	30130730		★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry eye syndrome	Pubtator	19850844	Associate	★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry eye syndrome	Pubtator	39884388	Stimulate	★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	17703176		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	Pubtator	23639073	Associate	★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	28891812, 29374213		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	35012533	Stimulate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	39960836	Associate	★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	CTD_human_DG	30579999		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	CTD_human_DG	30579999		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	BEFREE	30621017		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	Pubtator	34360900	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
External Carotid Artery Stenosis	External Carotid Artery Stenosis	CTD_human_DG	26564003		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	19344719, 25559603		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	11091274	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	35538132	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal inflammation	Gastrointestinal inflammation	BEFREE	19764067		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant cell arteritis	Pubtator	30333306	Associate	★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant cell arteritis	Pubtator	34237649	Stimulate	★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingivitis	BEFREE	28753101		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	22355254	Stimulate	★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	22355254	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	29399410		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	36430394	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	29399410		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	12946268, 21051441		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	11752021		★☆☆☆☆ Found in Text Mining only
Glycogen storage disease type II	Glycogen Storage Disease	BEFREE	30157273		★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	28057639, 34657151	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	12107104, 27245471, 31813786		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	12107104, 27245471	Associate	★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	31813786		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	36266640	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	35905218	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	30779709		★☆☆☆☆ Found in Text Mining only
Heart Valve Diseases	Heart valve disease	Pubtator	23417848	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	37995395	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	28387899	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis Chronic	Hepatitis	Pubtator	28387899	Stimulate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	22759382	Associate	★☆☆☆☆ Found in Text Mining only
Hermansky Pudlak syndrome 2	Hermansky-pudlak syndrome	Pubtator	27207797	Inhibit	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	10194423, 19773754, 24141626	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	11920617		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	26506526		★☆☆☆☆ Found in Text Mining only
Inclusion Body Myopathy, Sporadic	Inclusion body myopathy	BEFREE	12965263		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	21087446, 38149258	Stimulate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	33570153	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	11523046		★☆☆☆☆ Found in Text Mining only
Internal Carotid Artery Stenosis	Internal Carotid Artery Stenosis	CTD_human_DG	26564003		★☆☆☆☆ Found in Text Mining only
Interstitial Cystitis	Interstitial Cystitis	CTD_human_DG	18957084		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	23887838	Associate	★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	31799781		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	12919091	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	26828996		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	37540227	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	23919981	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Large Granular Lymphocytic	Lymphoblastic Leukemia	BEFREE	17875534		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	19388934, 28143565		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	28253295		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10385645, 17444857, 25151370, 29683022, 31582017, 31821689		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	21229279, 26240054		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	35159124	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	23480180	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	10385645		★☆☆☆☆ Found in Text Mining only
Localized scleroderma	Scleroderma	BEFREE	28450066		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	17550373, 31379071, 31783271	Associate	★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	31379071, 31783271		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	29721380		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	36688994	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Cutaneous	Cutaneous lupus erythematosus	Pubtator	20720564	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	19404947, 36741410	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	37204055	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	31476438, 31479651		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	29253517		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	37204055	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphadenitis	Lymphadenitis	BEFREE	25656804		★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis Hemophagocytic	Hemophagocytic lymphohistiocytosis	Pubtator	12930373, 33570715, 34461635	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis, Hemophagocytic	Lymphohistiocytosis	BEFREE	12930373, 27559680		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	10887135	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	15645433, 22914896		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	9699721		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	10393857	Inhibit	★☆☆☆☆ Found in Text Mining only
Macrophage Activation Syndrome	Macrophage Activation Syndrome	BEFREE	30952065, 31326996, 31476438		★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	30894217	Associate	★☆☆☆☆ Found in Text Mining only
Malformations of Cortical Development	Cortical development malformation	Pubtator	23639073	Associate	★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	CTD_human_DG	25162674		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	18925433		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	20068563, 22333315, 31699671		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	25151370, 26883105		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29721380		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	28253295		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	29721385		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	25135278, 29901197		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15959530, 17444857, 26898419, 27630154, 30685120		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	18925433		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	18925433		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	18925433		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	11571298	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	20948440		★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	18930766		★☆☆☆☆ Found in Text Mining only
MILES-CARPENTER X-LINKED MENTAL RETARDATION SYNDROME	MILES-CARPENTER X-Linked MENTAL RETARDATION SYNDROME	BEFREE	23049769		★☆☆☆☆ Found in Text Mining only
Morphea	Morphea	BEFREE	28450066		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	33952700	Associate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	36449533	Associate	★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	15645433		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	28389623	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	10079101, 21255008, 32457139	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	12020259, 29893515		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	39740367	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	31083544		★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	23150742		★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	Pubtator	23150742	Associate	★☆☆☆☆ Found in Text Mining only
Myositis Inclusion Body	Myositis	Pubtator	18420712, 24594700	Stimulate	★☆☆☆☆ Found in Text Mining only
Myositis Inclusion Body	Myositis	Pubtator	32259312	Associate	★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	39529136	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	24278236, 27765529, 32986378	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	31344361		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Neoplasms	Nasopharyngeal carcinoma	Pubtator	32986357	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10385645, 10680839, 11265771, 12184809, 12946268, 15063730, 15126779, 15925544, 20460520, 21051441, 22333315, 23769451, 26503055, 26637872, 26889977, 26898419, 27726306, 28638727, 28986561, 29207310, 29671006, 29683022, 29795405, 31097342, 31126321, 31208461, 31216458, 31451071, 31521609, 31775909, 31799781, 31803974		★☆☆☆☆ Found in Text Mining only
Nodular Sclerosis Classical Hodgkin Lymphoma	Classical Hodgkin lymphoma	BEFREE	11920617, 12866030		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	31821689		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	10680839, 21514686		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	34419146	Associate	★☆☆☆☆ Found in Text Mining only
Oculocutaneous albinism type 2	Oculocutaneous albinism	Pubtator	17550373	Stimulate	★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral Submucous Fibrosis	BEFREE	18768491		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	29637625		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	40374042	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	29721385		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	27490802, 36645174, 36798787, 37644593, 38143770	Associate	★☆☆☆☆ Found in Text Mining only
Painful Bladder Syndrome	Interstitial cystitis	CTD_human_DG	18957084		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	30685120		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	29157747, 32181755, 34143198, 38095640	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	30617967		★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	34764955	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Peripheral nervous system disease	Pubtator	24080983	Associate	★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	34360900	Inhibit	★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	30249452		★☆☆☆☆ Found in Text Mining only
Polymyalgia Rheumatica	Polymyalgia rheumatica	Pubtator	34237649	Associate	★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	16243485		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	CTD_human_DG	18422935		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	25135278, 29901197		★☆☆☆☆ Found in Text Mining only
Pruritus	Pruritus	Pubtator	38489975	Stimulate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	11310827, 17703176, 31389369		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	20555352, 21255008, 38115636	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	19229703	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	31527888, 32757672, 34335580, 34588774	Associate	★☆☆☆☆ Found in Text Mining only
Pyelonephritis	Pyelonephritis	BEFREE	30905425		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	15126779, 19095263		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	31542508		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	34987646	Associate	★☆☆☆☆ Found in Text Mining only
Retinal Detachment	Retinal detachment	Pubtator	26015767	Stimulate	★☆☆☆☆ Found in Text Mining only
Retinal Vein Occlusion	Retinal Vein Occlusion	BEFREE	31814701		★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis pigmentosa	Pubtator	39472110	Stimulate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	26037167	Associate	★☆☆☆☆ Found in Text Mining only
Rhegmatogenous Retinal Detachment Autosomal Dominant	Rhegmatogenous retinal detachment	Pubtator	32542038	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatic Heart Disease	Rheumatic heart disease	Pubtator	23417848	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	12932287, 17265155, 20604932, 25702175, 26367725		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	17550373, 24199653	Stimulate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	21255008, 25142485, 31783271, 34399367	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	25142485, 31783271		★☆☆☆☆ Found in Text Mining only
Sarcoidosis Pulmonary	Sarcoidosis	Pubtator	17550373	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma Localized	Scleroderma	Pubtator	28450066, 37372943, 37471168	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	21303517, 37372943	Associate	★☆☆☆☆ Found in Text Mining only
Secondary Biliary Cholangitis	Biliary Cholangitis	CTD_human_DG	18422935		★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	23639073	Associate	★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	34461635	Stimulate	★☆☆☆☆ Found in Text Mining only
Sicca Syndrome	Sjogren`s Syndrome	BEFREE	28582647		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	12384933	Stimulate	★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	34367157, 38229121	Associate	★☆☆☆☆ Found in Text Mining only
Spondylarthritis	Spondyloarthritis	BEFREE	17265155		★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	16847431	Stimulate	★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	40305235	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	18770863		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	29662196		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	34247149, 37930937	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of mouth	Oral cavity carcinoma	BEFREE	23769451		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	29286143		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	29690901, 32685487, 32860283, 34251747, 34413454	Associate	★☆☆☆☆ Found in Text Mining only
Stomatitis Aphthous	Aphthous stomatitis	Pubtator	21478439	Stimulate	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	27576738		★☆☆☆☆ Found in Text Mining only
Sweet Syndrome	Sweet Syndrome	BEFREE	28582647		★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	28582647		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	17265155		★☆☆☆☆ Found in Text Mining only
Systemic onset juvenile chronic arthritis	Arthritis	BEFREE	27296321, 30952065, 31326996		★☆☆☆☆ Found in Text Mining only
Thalassemia	Thalassemia	Pubtator	24894780	Stimulate	★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	31813786		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	36266640	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	27245471		★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	27245471	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	34868029	Stimulate	★☆☆☆☆ Found in Text Mining only
Toxic Epidermal Necrolysis	Stevens-Johnson Syndrome	BEFREE	27576738		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30111819		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	31921107, 35377948, 36472587, 40482645	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	33407095, 34517533	Associate	★☆☆☆☆ Found in Text Mining only
Venous Insufficiency	Venous insufficiency	Pubtator	29439934	Inhibit	★☆☆☆☆ Found in Text Mining only
Ventricular Dysfunction	Ventricular dysfunction	Pubtator	23150742	Associate	★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	32035094, 35464413, 35653192	Associate	★☆☆☆☆ Found in Text Mining only
Vitreoretinopathy Proliferative	Vitreoretinopathy	Pubtator	32542038	Stimulate	★☆☆☆☆ Found in Text Mining only