Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	4282
Gene name	Macrophage migration inhibitory factor
Gene symbol	MIF
Synonyms (NCBI Gene)	GIFGLIFMMIF
Chromosome	22
Chromosome location	22q11.23
Summary	This gene encodes a lymphokine involved in cell-mediated immunity, immunoregulation, and inflammation. It plays a role in the regulation of macrophage function in host defense through the suppression of anti-inflammatory effects of glucocorticoids. This l

Show/Hide all (56)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000664	hsa-miR-338-3p	Review	19935707
MIRT000046	hsa-miR-451a	Review	20026422
MIRT000046	hsa-miR-451a	ELISALuciferase reporter assayMicroarrayqRT-PCRWestern blot	19318487
MIRT000046	hsa-miR-451a	ELISALuciferase reporter assayMicroarrayqRT-PCRWestern blot	19318487
MIRT044670	hsa-miR-320a	CLASH	23622248
MIRT039145	hsa-miR-769-5p	CLASH	23622248
MIRT037678	hsa-miR-744-5p	CLASH	23622248
MIRT000046	hsa-miR-451a	Luciferase reporter assayWestern blot	24138931
MIRT000046	hsa-miR-451a	Luciferase reporter assay	26884830
MIRT000046	hsa-miR-451a	Luciferase reporter assay	28086136
MIRT000046	hsa-miR-451a	Luciferase reporter assay	28086136
MIRT000046	hsa-miR-451a	RNA-seq	33804111
MIRT733489	hsa-miR-1246	qRT-PCRWestern blotting	34112884
MIRT000046	hsa-miR-451a	qRT-PCRWestern blotting	34112884
MIRT734259	hsa-miR-654-5p	Luciferase reporter assayWestern blottingqRT-PCRELISA	31608058
MIRT000046	hsa-miR-451a	Luciferase reporter assay	38379319
MIRT1149085	hsa-miR-1324	CLIP-seq
MIRT1149086	hsa-miR-1537	CLIP-seq
MIRT1149087	hsa-miR-2277-3p	CLIP-seq
MIRT1149088	hsa-miR-3166	CLIP-seq
MIRT1149089	hsa-miR-3170	CLIP-seq
MIRT1149090	hsa-miR-342-5p	CLIP-seq
MIRT1149091	hsa-miR-3960	CLIP-seq
MIRT1149092	hsa-miR-451	CLIP-seq
MIRT1149093	hsa-miR-4532	CLIP-seq
MIRT1149094	hsa-miR-4651	CLIP-seq
MIRT1149095	hsa-miR-4664-5p	CLIP-seq
MIRT1149096	hsa-miR-4713-5p	CLIP-seq
MIRT1149097	hsa-miR-4738-5p	CLIP-seq
MIRT1149098	hsa-miR-4773	CLIP-seq
MIRT1149099	hsa-miR-541	CLIP-seq
MIRT1149100	hsa-miR-608	CLIP-seq
MIRT1149085	hsa-miR-1324	CLIP-seq
MIRT1149086	hsa-miR-1537	CLIP-seq
MIRT1149087	hsa-miR-2277-3p	CLIP-seq
MIRT1149088	hsa-miR-3166	CLIP-seq
MIRT1149089	hsa-miR-3170	CLIP-seq
MIRT1149090	hsa-miR-342-5p	CLIP-seq
MIRT1149091	hsa-miR-3960	CLIP-seq
MIRT2042438	hsa-miR-4286	CLIP-seq
MIRT1149092	hsa-miR-451	CLIP-seq
MIRT1149093	hsa-miR-4532	CLIP-seq
MIRT1149094	hsa-miR-4651	CLIP-seq
MIRT1149095	hsa-miR-4664-5p	CLIP-seq
MIRT1149096	hsa-miR-4713-5p	CLIP-seq
MIRT1149097	hsa-miR-4738-5p	CLIP-seq
MIRT1149098	hsa-miR-4773	CLIP-seq
MIRT1149099	hsa-miR-541	CLIP-seq
MIRT1149100	hsa-miR-608	CLIP-seq
MIRT1149085	hsa-miR-1324	CLIP-seq
MIRT1149087	hsa-miR-2277-3p	CLIP-seq
MIRT1149088	hsa-miR-3166	CLIP-seq
MIRT1149091	hsa-miR-3960	CLIP-seq
MIRT1149093	hsa-miR-4532	CLIP-seq
MIRT1149097	hsa-miR-4738-5p	CLIP-seq
MIRT1149098	hsa-miR-4773	CLIP-seq

Show/Hide all (5)

Transcription factor	Regulation	Reference
HBP1	Repression	20383199
HIF1A	Activation	20727156
NFKB1	Unknown	18710704
RELA	Unknown	18710704
SP1	Activation	18034423

Show/Hide all (73)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001516	Process	Prostaglandin biosynthetic process	IDA	12782713
GO:0001819	Process	Positive regulation of cytokine production	IDA	19602265
GO:0002020	Function	Protease binding	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002906	Process	Negative regulation of mature B cell apoptotic process	IEA
GO:0004167	Function	Dopachrome isomerase activity	IDA	17526494
GO:0004167	Function	Dopachrome isomerase activity	IEA
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IDA	12782713
GO:0005125	Function	Cytokine activity	IEA
GO:0005126	Function	Cytokine receptor binding	IDA	21817065
GO:0005126	Function	Cytokine receptor binding	IPI	17045821
GO:0005515	Function	Protein binding	IPI	12681488, 17526494, 18677096, 25416956, 26280537, 28726057, 31515488
GO:0005576	Component	Extracellular region	HDA	27068509
GO:0005576	Component	Extracellular region	IDA	12782713
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	21817065
GO:0005615	Component	Extracellular space	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	24569872
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA	24569872
GO:0006954	Process	Inflammatory response	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IDA	12782713
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	10562313
GO:0009986	Component	Cell surface	IDA	12782713
GO:0010629	Process	Negative regulation of gene expression	IDA	10562313
GO:0010760	Process	Negative regulation of macrophage chemotaxis	IDA	21817065
GO:0016853	Function	Isomerase activity	IEA
GO:0019752	Process	Carboxylic acid metabolic process	IDA	12782713
GO:0030330	Process	DNA damage response, signal transduction by p53 class mediator	IEA
GO:0030336	Process	Negative regulation of cell migration	IMP	22952837
GO:0030890	Process	Positive regulation of B cell proliferation	IDA	12782713
GO:0031666	Process	Positive regulation of lipopolysaccharide-mediated signaling pathway	IEA
GO:0031982	Component	Vesicle	HDA	19190083
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IDA	21817065
GO:0033033	Process	Negative regulation of myeloid cell apoptotic process	IEA
GO:0034774	Component	Secretory granule lumen	TAS
GO:0042056	Function	Chemoattractant activity	IDA	19602265
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0042327	Process	Positive regulation of phosphorylation	IDA	12782713
GO:0042802	Function	Identical protein binding	IPI	20534506, 25416956, 31515488, 32296183
GO:0043030	Process	Regulation of macrophage activation	NAS	12782713
GO:0043066	Process	Negative regulation of apoptotic process	IDA	12782713
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043518	Process	Negative regulation of DNA damage response, signal transduction by p53 class mediator	IDA	17045821
GO:0043518	Process	Negative regulation of DNA damage response, signal transduction by p53 class mediator	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0048146	Process	Positive regulation of fibroblast proliferation	IDA	12782713
GO:0048146	Process	Positive regulation of fibroblast proliferation	IEA
GO:0050178	Function	Phenylpyruvate tautomerase activity	IBA
GO:0050178	Function	Phenylpyruvate tautomerase activity	IDA	16285950, 21817065
GO:0050178	Function	Phenylpyruvate tautomerase activity	IEA
GO:0050918	Process	Positive chemotaxis	IEA
GO:0051248	Process	Negative regulation of protein metabolic process	IEA
GO:0061078	Process	Positive regulation of prostaglandin secretion involved in immune response	IEA
GO:0061081	Process	Positive regulation of myeloid leukocyte cytokine production involved in immune response	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337, 23533145
GO:0070207	Process	Protein homotrimerization	IPI	17526494
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	12782713, 17045821
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IGI	21817065
GO:0080135	Process	Regulation of cellular response to stress	IEA
GO:0090238	Process	Positive regulation of arachidonate secretion	IEA
GO:0090398	Process	Cellular senescence	IEA
GO:0141163	Process	Positive regulation of cAMP/PKA signal transduction	IDA	17045821
GO:1902166	Process	Negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IDA	17045821
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS
GO:2000343	Process	Positive regulation of chemokine (C-X-C motif) ligand 2 production	IEA
GO:2000773	Process	Negative regulation of cellular senescence	IDA	10562313

MIM	HGNC	e!Ensembl
153620	7097	ENSG00000240972

P14174

Protein name

Macrophage migration inhibitory factor (MIF) (EC 5.3.2.1) (Glycosylation-inhibiting factor) (GIF) (L-dopachrome isomerase) (L-dopachrome tautomerase) (EC 5.3.3.12) (Phenylpyruvate tautomerase)

Protein function

Pro-inflammatory cytokine involved in the innate immune response to bacterial pathogens (PubMed:15908412, PubMed:17443469, PubMed:23776208). The expression of MIF at sites of inflammation suggests a role as mediator in regulating the function of

PDB

1CA7 , 1CGQ , 1GCZ , 1GD0 , 1GIF , 1LJT , 1MIF , 1P1G , 2OOH , 2OOW , 2OOZ , 3B9S , 3CE4 , 3DJH , 3DJI , 3HOF , 3IJG , 3IJJ , 3JSF , 3JSG , 3JTU , 3L5P , 3L5R , 3L5S , 3L5T , 3L5U , 3L5V , 3SMB , 3SMC , 3U18 , 3WNR , 3WNS , 3WNT , 4ETG , 4EUI , 4EVG , 4F2K , 4GRN , 4GRO , 4GRP , 4GRQ , 4GRR , 4GRU , 4GUM , 4K9G , 4OSF , 4OYQ , 4P01 , 4P0H , 4PKK , 4PKZ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01187	MIF	2 → 115	Macrophage migration inhibitory factor (MIF)	Domain

Sequence

MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALC
SLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

Sequence length

115

Interactions

View interactions

	KEGG		Reactome
	Tyrosine metabolism Phenylalanine metabolism Metabolic pathways		Cell surface interactions at the vascular wall Neutrophil degranulation Gene and protein expression by JAK-STAT signaling after Interleukin-12 stimulation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (37)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANXIETY DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, RHEUMATOID	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE AIRWAY DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLITIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CYSTIC FIBROSIS	—	CTD, Disgenet, Orphanet CTD, Disgenet, Orphanet CTD, Disgenet, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma susceptibility 1	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG DISEASES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MEMORY DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MESOTHELIOMA, MALIGNANT	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIF-related disorder	Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY DISEASE, CHRONIC OBSTRUCTIVE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS, SYSTEMIC JUVENILE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEPSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STEVENS-JOHNSON SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC-ONSET JUVENILE IDIOPATHIC ARTHRITIS	—	ClinVar, Orphanet ClinVar, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

MIF (macrophage migration inhibitory factor)