MICB (MHC class I polypeptide-related sequence B)

Gene

• Entrez ID: 4277
• Gene name: MHC class I polypeptide-related sequence B
• Gene symbol: MICB
• Synonyms (NCBI Gene): PERB11.2
• Chromosome: 6
• Chromosome location: 6p21.33
• Summary: This gene encodes a heavily glycosylated protein which is a ligand for the NKG2D type II receptor. Binding of the ligand activates the cytolytic response of natural killer (NK) cells, CD8 alphabeta T cells, and gammadelta T cells which express the recepto

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT001999	hcmv-miR-UL112-3p	Luciferase reporter assay	17641203
MIRT001999	hcmv-miR-UL112-3p	Luciferase reporter assay	17641203
MIRT001999	hcmv-miR-UL112-3p	Luciferase reporter assay	17641203
MIRT691422	hsa-miR-6856-3p	HITS-CLIP	23313552
MIRT691421	hsa-miR-129-1-3p	HITS-CLIP	23313552
MIRT691420	hsa-miR-129-2-3p	HITS-CLIP	23313552
MIRT683791	hsa-miR-5088-5p	HITS-CLIP	23313552
MIRT683789	hsa-miR-141-5p	HITS-CLIP	23313552
MIRT691419	hsa-miR-140-3p	HITS-CLIP	23313552
MIRT683787	hsa-miR-3151-3p	HITS-CLIP	23313552
MIRT691418	hsa-miR-6886-3p	HITS-CLIP	23313552
MIRT683785	hsa-miR-760	HITS-CLIP	23313552
MIRT683781	hsa-miR-3192-3p	HITS-CLIP	23313552
MIRT683779	hsa-miR-3692-3p	HITS-CLIP	23313552
MIRT683791	hsa-miR-5088-5p	HITS-CLIP	23313552
MIRT683790	hsa-miR-6805-5p	HITS-CLIP	23313552
MIRT683789	hsa-miR-141-5p	HITS-CLIP	23313552
MIRT683788	hsa-miR-6798-5p	HITS-CLIP	23313552
MIRT683787	hsa-miR-3151-3p	HITS-CLIP	23313552
MIRT683786	hsa-miR-103a-2-5p	HITS-CLIP	23313552
MIRT683785	hsa-miR-760	HITS-CLIP	23313552
MIRT683784	hsa-miR-6815-3p	HITS-CLIP	23313552
MIRT683783	hsa-miR-6846-5p	HITS-CLIP	23313552
MIRT683782	hsa-miR-6848-5p	HITS-CLIP	23313552
MIRT683781	hsa-miR-3192-3p	HITS-CLIP	23313552
MIRT683780	hsa-miR-3977	HITS-CLIP	23313552
MIRT683779	hsa-miR-3692-3p	HITS-CLIP	23313552
MIRT100281	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT100277	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT439155	hsa-let-7c-5p	3'LIFE	25074381
MIRT100281	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT100276	hsa-miR-17-5p	HITS-CLIP	22473208
MIRT100288	hsa-miR-20b-5p	HITS-CLIP	22473208
MIRT100278	hsa-miR-93-5p	HITS-CLIP	22473208
MIRT100297	hsa-miR-519d-3p	HITS-CLIP	22473208
MIRT100277	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT439155	hsa-let-7c-5p	3'LIFE	25074381
MIRT753612	hsa-miR-1910-3p	PAR-CLIP	26701625
MIRT753613	hsa-miR-6511a-5p	PAR-CLIP	26701625
MIRT753612	hsa-miR-1910-3p	PAR-CLIP	27292025
MIRT753613	hsa-miR-6511a-5p	PAR-CLIP	27292025
MIRT691422	hsa-miR-6856-3p	HITS-CLIP	23313552
MIRT691421	hsa-miR-129-1-3p	HITS-CLIP	23313552
MIRT691420	hsa-miR-129-2-3p	HITS-CLIP	23313552
MIRT683791	hsa-miR-5088-5p	HITS-CLIP	23313552
MIRT683789	hsa-miR-141-5p	HITS-CLIP	23313552
MIRT691419	hsa-miR-140-3p	HITS-CLIP	23313552
MIRT683787	hsa-miR-3151-3p	HITS-CLIP	23313552
MIRT691418	hsa-miR-6886-3p	HITS-CLIP	23313552
MIRT683785	hsa-miR-760	HITS-CLIP	23313552
MIRT683781	hsa-miR-3192-3p	HITS-CLIP	23313552
MIRT683779	hsa-miR-3692-3p	HITS-CLIP	23313552
MIRT683791	hsa-miR-5088-5p	HITS-CLIP	23313552
MIRT683790	hsa-miR-6805-5p	HITS-CLIP	23313552
MIRT683789	hsa-miR-141-5p	HITS-CLIP	23313552
MIRT683788	hsa-miR-6798-5p	HITS-CLIP	23313552
MIRT683787	hsa-miR-3151-3p	HITS-CLIP	23313552
MIRT683786	hsa-miR-103a-2-5p	HITS-CLIP	23313552
MIRT683785	hsa-miR-760	HITS-CLIP	23313552
MIRT683784	hsa-miR-6815-3p	HITS-CLIP	23313552
MIRT683783	hsa-miR-6846-5p	HITS-CLIP	23313552
MIRT683782	hsa-miR-6848-5p	HITS-CLIP	23313552
MIRT683781	hsa-miR-3192-3p	HITS-CLIP	23313552
MIRT683780	hsa-miR-3977	HITS-CLIP	23313552
MIRT683779	hsa-miR-3692-3p	HITS-CLIP	23313552
MIRT1148282	hsa-let-7a	CLIP-seq
MIRT1148283	hsa-let-7b	CLIP-seq
MIRT1148284	hsa-let-7c	CLIP-seq
MIRT1148285	hsa-let-7d	CLIP-seq
MIRT1148286	hsa-let-7e	CLIP-seq
MIRT1148287	hsa-let-7f	CLIP-seq
MIRT1148288	hsa-let-7g	CLIP-seq
MIRT1148289	hsa-let-7i	CLIP-seq
MIRT1148290	hsa-miR-103a	CLIP-seq
MIRT1148291	hsa-miR-107	CLIP-seq
MIRT1148292	hsa-miR-1184	CLIP-seq
MIRT1148293	hsa-miR-1207-3p	CLIP-seq
MIRT1148294	hsa-miR-122	CLIP-seq
MIRT1148295	hsa-miR-1228	CLIP-seq
MIRT1148296	hsa-miR-1237	CLIP-seq
MIRT1148297	hsa-miR-1257	CLIP-seq
MIRT1148298	hsa-miR-1262	CLIP-seq
MIRT1148299	hsa-miR-1269	CLIP-seq
MIRT1148300	hsa-miR-1269b	CLIP-seq
MIRT1148301	hsa-miR-1273e	CLIP-seq
MIRT1148302	hsa-miR-1276	CLIP-seq
MIRT1148303	hsa-miR-1288	CLIP-seq
MIRT1148304	hsa-miR-129-3p	CLIP-seq
MIRT1148305	hsa-miR-1301	CLIP-seq
MIRT1148306	hsa-miR-141	CLIP-seq
MIRT1148307	hsa-miR-198	CLIP-seq
MIRT1148308	hsa-miR-200a	CLIP-seq
MIRT1148309	hsa-miR-202	CLIP-seq
MIRT1148310	hsa-miR-2054	CLIP-seq
MIRT1148311	hsa-miR-217	CLIP-seq
MIRT1148312	hsa-miR-24	CLIP-seq
MIRT1148313	hsa-miR-29a	CLIP-seq
MIRT1148314	hsa-miR-29b	CLIP-seq
MIRT1148315	hsa-miR-29c	CLIP-seq
MIRT1148316	hsa-miR-302a	CLIP-seq
MIRT1148317	hsa-miR-302b	CLIP-seq
MIRT1148318	hsa-miR-302c	CLIP-seq
MIRT1148319	hsa-miR-302d	CLIP-seq
MIRT1148320	hsa-miR-302e	CLIP-seq
MIRT1148321	hsa-miR-30a	CLIP-seq
MIRT1148322	hsa-miR-30b	CLIP-seq
MIRT1148323	hsa-miR-30c	CLIP-seq
MIRT1148324	hsa-miR-30d	CLIP-seq
MIRT1148325	hsa-miR-30e	CLIP-seq
MIRT1148326	hsa-miR-3120-5p	CLIP-seq
MIRT1148327	hsa-miR-3122	CLIP-seq
MIRT1148328	hsa-miR-3163	CLIP-seq
MIRT1148329	hsa-miR-3182	CLIP-seq
MIRT1148330	hsa-miR-3185	CLIP-seq
MIRT1148331	hsa-miR-3190	CLIP-seq
MIRT1148332	hsa-miR-3192	CLIP-seq
MIRT1148333	hsa-miR-3545-3p	CLIP-seq
MIRT1148334	hsa-miR-3613-3p	CLIP-seq
MIRT1148335	hsa-miR-3622a-5p	CLIP-seq
MIRT1148336	hsa-miR-365	CLIP-seq
MIRT1148337	hsa-miR-3663-3p	CLIP-seq
MIRT1148338	hsa-miR-3664-5p	CLIP-seq
MIRT1148339	hsa-miR-3672	CLIP-seq
MIRT1148340	hsa-miR-3692	CLIP-seq
MIRT1148341	hsa-miR-3714	CLIP-seq
MIRT1148342	hsa-miR-371-5p	CLIP-seq
MIRT1148343	hsa-miR-371b-5p	CLIP-seq
MIRT1148344	hsa-miR-372	CLIP-seq
MIRT1148345	hsa-miR-373	CLIP-seq
MIRT1148346	hsa-miR-3913-5p	CLIP-seq
MIRT1148347	hsa-miR-411	CLIP-seq
MIRT1148348	hsa-miR-4269	CLIP-seq
MIRT1148349	hsa-miR-4284	CLIP-seq
MIRT1148350	hsa-miR-4290	CLIP-seq
MIRT1148351	hsa-miR-4294	CLIP-seq
MIRT1148352	hsa-miR-4311	CLIP-seq
MIRT1148353	hsa-miR-4418	CLIP-seq
MIRT1148354	hsa-miR-4432	CLIP-seq
MIRT1148355	hsa-miR-4433	CLIP-seq
MIRT1148356	hsa-miR-4458	CLIP-seq
MIRT1148357	hsa-miR-4480	CLIP-seq
MIRT1148358	hsa-miR-4500	CLIP-seq
MIRT1148359	hsa-miR-450b-3p	CLIP-seq
MIRT1148360	hsa-miR-4514	CLIP-seq
MIRT1148361	hsa-miR-4515	CLIP-seq
MIRT1148362	hsa-miR-4522	CLIP-seq
MIRT1148363	hsa-miR-4529-3p	CLIP-seq
MIRT1148364	hsa-miR-4637	CLIP-seq
MIRT1148365	hsa-miR-4645-5p	CLIP-seq
MIRT1148366	hsa-miR-4649-3p	CLIP-seq
MIRT1148367	hsa-miR-4673	CLIP-seq
MIRT1148368	hsa-miR-4692	CLIP-seq
MIRT1148369	hsa-miR-4701-3p	CLIP-seq
MIRT1148370	hsa-miR-4717-5p	CLIP-seq
MIRT1148371	hsa-miR-4724-5p	CLIP-seq
MIRT1148372	hsa-miR-4731-5p	CLIP-seq
MIRT1148373	hsa-miR-4740-5p	CLIP-seq
MIRT1148374	hsa-miR-4755-3p	CLIP-seq
MIRT1148375	hsa-miR-4789-3p	CLIP-seq
MIRT1148376	hsa-miR-4797-5p	CLIP-seq
MIRT1148377	hsa-miR-491-3p	CLIP-seq
MIRT1148378	hsa-miR-499-5p	CLIP-seq
MIRT1148379	hsa-miR-501-3p	CLIP-seq
MIRT1148380	hsa-miR-502-3p	CLIP-seq
MIRT1148381	hsa-miR-5047	CLIP-seq
MIRT1148382	hsa-miR-509-3-5p	CLIP-seq
MIRT1148383	hsa-miR-509-5p	CLIP-seq
MIRT1148384	hsa-miR-520a-3p	CLIP-seq
MIRT1148385	hsa-miR-520a-5p	CLIP-seq
MIRT1148386	hsa-miR-520b	CLIP-seq
MIRT1148387	hsa-miR-520c-3p	CLIP-seq
MIRT1148388	hsa-miR-520d-3p	CLIP-seq
MIRT1148389	hsa-miR-520e	CLIP-seq
MIRT1148390	hsa-miR-520f	CLIP-seq
MIRT1148391	hsa-miR-525-5p	CLIP-seq
MIRT1148392	hsa-miR-542-3p	CLIP-seq
MIRT1148393	hsa-miR-545	CLIP-seq
MIRT1148394	hsa-miR-564	CLIP-seq
MIRT1148395	hsa-miR-578	CLIP-seq
MIRT1148396	hsa-miR-583	CLIP-seq
MIRT1148397	hsa-miR-633	CLIP-seq
MIRT1148398	hsa-miR-636	CLIP-seq
MIRT1148399	hsa-miR-643	CLIP-seq
MIRT1148400	hsa-miR-661	CLIP-seq
MIRT1148401	hsa-miR-7	CLIP-seq
MIRT1148402	hsa-miR-759	CLIP-seq
MIRT1148403	hsa-miR-767-5p	CLIP-seq
MIRT1148404	hsa-miR-769-3p	CLIP-seq
MIRT1148405	hsa-miR-940	CLIP-seq
MIRT1148406	hsa-miR-98	CLIP-seq
MIRT2042205	hsa-miR-1207-5p	CLIP-seq
MIRT2042206	hsa-miR-1283	CLIP-seq
MIRT2042207	hsa-miR-138	CLIP-seq
MIRT1148311	hsa-miR-217	CLIP-seq
MIRT1148316	hsa-miR-302a	CLIP-seq
MIRT1148317	hsa-miR-302b	CLIP-seq
MIRT1148318	hsa-miR-302c	CLIP-seq
MIRT1148319	hsa-miR-302d	CLIP-seq
MIRT1148320	hsa-miR-302e	CLIP-seq
MIRT1148332	hsa-miR-3192	CLIP-seq
MIRT1148334	hsa-miR-3613-3p	CLIP-seq
MIRT2042208	hsa-miR-3680	CLIP-seq
MIRT1148344	hsa-miR-372	CLIP-seq
MIRT1148345	hsa-miR-373	CLIP-seq
MIRT2042209	hsa-miR-376a	CLIP-seq
MIRT2042210	hsa-miR-376b	CLIP-seq
MIRT2042211	hsa-miR-380	CLIP-seq
MIRT2042212	hsa-miR-4270	CLIP-seq
MIRT2042213	hsa-miR-4299	CLIP-seq
MIRT1148353	hsa-miR-4418	CLIP-seq
MIRT1148355	hsa-miR-4433	CLIP-seq
MIRT2042214	hsa-miR-4441	CLIP-seq
MIRT2042215	hsa-miR-4496	CLIP-seq
MIRT1148360	hsa-miR-4514	CLIP-seq
MIRT1148365	hsa-miR-4645-5p	CLIP-seq
MIRT1148367	hsa-miR-4673	CLIP-seq
MIRT2042216	hsa-miR-4684-5p	CLIP-seq
MIRT1148368	hsa-miR-4692	CLIP-seq
MIRT2042217	hsa-miR-4710	CLIP-seq
MIRT2042218	hsa-miR-4735-5p	CLIP-seq
MIRT2042219	hsa-miR-4763-3p	CLIP-seq
MIRT2042220	hsa-miR-4792	CLIP-seq
MIRT2042221	hsa-miR-4798-3p	CLIP-seq
MIRT1148382	hsa-miR-509-3-5p	CLIP-seq
MIRT1148383	hsa-miR-509-5p	CLIP-seq
MIRT2042222	hsa-miR-512-3p	CLIP-seq
MIRT1148384	hsa-miR-520a-3p	CLIP-seq
MIRT1148386	hsa-miR-520b	CLIP-seq
MIRT1148387	hsa-miR-520c-3p	CLIP-seq
MIRT1148388	hsa-miR-520d-3p	CLIP-seq
MIRT1148389	hsa-miR-520e	CLIP-seq
MIRT2042223	hsa-miR-561	CLIP-seq
MIRT2042224	hsa-miR-765	CLIP-seq
MIRT2042225	hsa-miR-873	CLIP-seq
MIRT1148405	hsa-miR-940	CLIP-seq
MIRT1148290	hsa-miR-103a	CLIP-seq
MIRT1148291	hsa-miR-107	CLIP-seq
MIRT1148295	hsa-miR-1228	CLIP-seq
MIRT1148301	hsa-miR-1273e	CLIP-seq
MIRT1148305	hsa-miR-1301	CLIP-seq
MIRT1148306	hsa-miR-141	CLIP-seq
MIRT1148308	hsa-miR-200a	CLIP-seq
MIRT1148311	hsa-miR-217	CLIP-seq
MIRT1148316	hsa-miR-302a	CLIP-seq
MIRT1148317	hsa-miR-302b	CLIP-seq
MIRT1148318	hsa-miR-302c	CLIP-seq
MIRT1148319	hsa-miR-302d	CLIP-seq
MIRT1148320	hsa-miR-302e	CLIP-seq
MIRT1148327	hsa-miR-3122	CLIP-seq
MIRT1148332	hsa-miR-3192	CLIP-seq
MIRT1148333	hsa-miR-3545-3p	CLIP-seq
MIRT1148341	hsa-miR-3714	CLIP-seq
MIRT1148344	hsa-miR-372	CLIP-seq
MIRT1148345	hsa-miR-373	CLIP-seq
MIRT1148346	hsa-miR-3913-5p	CLIP-seq
MIRT1148353	hsa-miR-4418	CLIP-seq
MIRT1148354	hsa-miR-4432	CLIP-seq
MIRT1148355	hsa-miR-4433	CLIP-seq
MIRT1148357	hsa-miR-4480	CLIP-seq
MIRT1148359	hsa-miR-450b-3p	CLIP-seq
MIRT1148360	hsa-miR-4514	CLIP-seq
MIRT1148368	hsa-miR-4692	CLIP-seq
MIRT1148378	hsa-miR-499-5p	CLIP-seq
MIRT1148381	hsa-miR-5047	CLIP-seq
MIRT1148382	hsa-miR-509-3-5p	CLIP-seq
MIRT1148383	hsa-miR-509-5p	CLIP-seq
MIRT1148384	hsa-miR-520a-3p	CLIP-seq
MIRT1148386	hsa-miR-520b	CLIP-seq
MIRT1148387	hsa-miR-520c-3p	CLIP-seq
MIRT1148388	hsa-miR-520d-3p	CLIP-seq
MIRT1148389	hsa-miR-520e	CLIP-seq
MIRT1148390	hsa-miR-520f	CLIP-seq
MIRT1148398	hsa-miR-636	CLIP-seq
MIRT1148404	hsa-miR-769-3p	CLIP-seq
MIRT1148405	hsa-miR-940	CLIP-seq
MIRT1148301	hsa-miR-1273e	CLIP-seq
MIRT2390877	hsa-miR-15a	CLIP-seq
MIRT2390878	hsa-miR-15b	CLIP-seq
MIRT2390879	hsa-miR-16	CLIP-seq
MIRT2390880	hsa-miR-195	CLIP-seq
MIRT2390881	hsa-miR-2278	CLIP-seq
MIRT1148316	hsa-miR-302a	CLIP-seq
MIRT1148317	hsa-miR-302b	CLIP-seq
MIRT1148318	hsa-miR-302c	CLIP-seq
MIRT1148319	hsa-miR-302d	CLIP-seq
MIRT1148320	hsa-miR-302e	CLIP-seq
MIRT1148332	hsa-miR-3192	CLIP-seq
MIRT1148344	hsa-miR-372	CLIP-seq
MIRT1148345	hsa-miR-373	CLIP-seq
MIRT2390882	hsa-miR-424	CLIP-seq
MIRT2390883	hsa-miR-497	CLIP-seq
MIRT1148384	hsa-miR-520a-3p	CLIP-seq
MIRT1148386	hsa-miR-520b	CLIP-seq
MIRT1148387	hsa-miR-520c-3p	CLIP-seq
MIRT1148388	hsa-miR-520d-3p	CLIP-seq
MIRT1148389	hsa-miR-520e	CLIP-seq
MIRT1148390	hsa-miR-520f	CLIP-seq
MIRT1148393	hsa-miR-545	CLIP-seq
MIRT1148398	hsa-miR-636	CLIP-seq
MIRT1148290	hsa-miR-103a	CLIP-seq
MIRT1148291	hsa-miR-107	CLIP-seq
MIRT1148305	hsa-miR-1301	CLIP-seq
MIRT1148306	hsa-miR-141	CLIP-seq
MIRT1148308	hsa-miR-200a	CLIP-seq
MIRT1148381	hsa-miR-5047	CLIP-seq
MIRT2042206	hsa-miR-1283	CLIP-seq
MIRT1148326	hsa-miR-3120-5p	CLIP-seq
MIRT1148334	hsa-miR-3613-3p	CLIP-seq
MIRT1148338	hsa-miR-3664-5p	CLIP-seq
MIRT1148339	hsa-miR-3672	CLIP-seq
MIRT1148342	hsa-miR-371-5p	CLIP-seq
MIRT1148343	hsa-miR-371b-5p	CLIP-seq
MIRT1148362	hsa-miR-4522	CLIP-seq
MIRT2042216	hsa-miR-4684-5p	CLIP-seq
MIRT1148290	hsa-miR-103a	CLIP-seq
MIRT1148291	hsa-miR-107	CLIP-seq
MIRT2570766	hsa-miR-10a	CLIP-seq
MIRT2570767	hsa-miR-10b	CLIP-seq
MIRT2570768	hsa-miR-1208	CLIP-seq
MIRT1148299	hsa-miR-1269	CLIP-seq
MIRT1148300	hsa-miR-1269b	CLIP-seq
MIRT2042206	hsa-miR-1283	CLIP-seq
MIRT1148303	hsa-miR-1288	CLIP-seq
MIRT1148305	hsa-miR-1301	CLIP-seq
MIRT1148306	hsa-miR-141	CLIP-seq
MIRT2570769	hsa-miR-183	CLIP-seq
MIRT1148308	hsa-miR-200a	CLIP-seq
MIRT2570770	hsa-miR-296-5p	CLIP-seq
MIRT1148326	hsa-miR-3120-5p	CLIP-seq
MIRT1148334	hsa-miR-3613-3p	CLIP-seq
MIRT1148338	hsa-miR-3664-5p	CLIP-seq
MIRT1148339	hsa-miR-3672	CLIP-seq
MIRT1148342	hsa-miR-371-5p	CLIP-seq
MIRT1148343	hsa-miR-371b-5p	CLIP-seq
MIRT1148361	hsa-miR-4515	CLIP-seq
MIRT2570771	hsa-miR-4517	CLIP-seq
MIRT1148362	hsa-miR-4522	CLIP-seq
MIRT1148363	hsa-miR-4529-3p	CLIP-seq
MIRT2042216	hsa-miR-4684-5p	CLIP-seq
MIRT1148371	hsa-miR-4724-5p	CLIP-seq
MIRT1148373	hsa-miR-4740-5p	CLIP-seq
MIRT2570772	hsa-miR-4742-3p	CLIP-seq
MIRT2570773	hsa-miR-4758-3p	CLIP-seq
MIRT1148381	hsa-miR-5047	CLIP-seq
MIRT2570774	hsa-miR-889	CLIP-seq
MIRT1148290	hsa-miR-103a	CLIP-seq
MIRT1148291	hsa-miR-107	CLIP-seq
MIRT2570766	hsa-miR-10a	CLIP-seq
MIRT2570767	hsa-miR-10b	CLIP-seq
MIRT2570768	hsa-miR-1208	CLIP-seq
MIRT1148299	hsa-miR-1269	CLIP-seq
MIRT1148300	hsa-miR-1269b	CLIP-seq
MIRT2042206	hsa-miR-1283	CLIP-seq
MIRT1148303	hsa-miR-1288	CLIP-seq
MIRT1148305	hsa-miR-1301	CLIP-seq
MIRT1148306	hsa-miR-141	CLIP-seq
MIRT2570769	hsa-miR-183	CLIP-seq
MIRT1148308	hsa-miR-200a	CLIP-seq
MIRT2570770	hsa-miR-296-5p	CLIP-seq
MIRT1148326	hsa-miR-3120-5p	CLIP-seq
MIRT2685014	hsa-miR-323-5p	CLIP-seq
MIRT1148334	hsa-miR-3613-3p	CLIP-seq
MIRT1148338	hsa-miR-3664-5p	CLIP-seq
MIRT1148339	hsa-miR-3672	CLIP-seq
MIRT1148342	hsa-miR-371-5p	CLIP-seq
MIRT1148343	hsa-miR-371b-5p	CLIP-seq
MIRT2685015	hsa-miR-4455	CLIP-seq
MIRT1148361	hsa-miR-4515	CLIP-seq
MIRT2570771	hsa-miR-4517	CLIP-seq
MIRT1148362	hsa-miR-4522	CLIP-seq
MIRT1148363	hsa-miR-4529-3p	CLIP-seq
MIRT2042216	hsa-miR-4684-5p	CLIP-seq
MIRT1148371	hsa-miR-4724-5p	CLIP-seq
MIRT1148373	hsa-miR-4740-5p	CLIP-seq
MIRT2570772	hsa-miR-4742-3p	CLIP-seq
MIRT2570773	hsa-miR-4758-3p	CLIP-seq
MIRT1148381	hsa-miR-5047	CLIP-seq
MIRT2685016	hsa-miR-609	CLIP-seq
MIRT2685017	hsa-miR-876-3p	CLIP-seq
MIRT2570774	hsa-miR-889	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ESR1	Unknown	23527639
HDAC1	Unknown	17625602
HSF1	Activation	19139882
SP1	Activation	19139882
SP1	Unknown	23527639
SP3	Unknown	23527639

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002429	Process	Immune response-activating cell surface receptor signaling pathway	IDA	11491531
GO:0005615	Component	Extracellular space	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006955	Process	Immune response	IBA
GO:0006979	Process	Response to oxidative stress	IDA	11287116
GO:0009408	Process	Response to heat	IDA	9497295
GO:0009408	Process	Response to heat	IEA
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009986	Component	Cell surface	ISS
GO:0016020	Component	Membrane	IEA
GO:0031348	Process	Negative regulation of defense response	IEA
GO:0031640	Process	Killing of cells of another organism	IEA
GO:0032526	Process	Response to retinoic acid	IDA	12569559
GO:0046629	Process	Gamma-delta T cell activation	IDA	9497295
GO:0046629	Process	Gamma-delta T cell activation	IEA
GO:0046703	Function	Natural killer cell lectin-like receptor binding	IDA	11491531
GO:0046703	Function	Natural killer cell lectin-like receptor binding	IEA
GO:0050689	Process	Negative regulation of defense response to virus by host	IDA	11239445, 12782710
GO:0050776	Process	Regulation of immune response	IEA

Other IDs

• MIM: 602436
• HGNC: 7091
• e!Ensembl: ENSG00000204516

Protein

• UniProt ID: Q29980
• Protein name: MHC class I polypeptide-related sequence B (MIC-B)
• Protein function: Widely expressed membrane-bound protein which acts as a ligand to stimulate an activating receptor KLRK1/NKG2D, expressed on the surface of essentially all human natural killer (NK), gammadelta T and CD8+ alphabeta T-cells (PubMed:11491531, PubM
• PDB: 1JE6, 2WY3
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00129	MHC_I	24 → 201	Class I Histocompatibility antigen, domains alpha 1 and 2	Domain
  PF07654	C1-set	208 → 289	Immunoglobulin C1-set domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed with the exception of the central nervous system where it is absent. Expressed in many, but not all, epithelial tumors of lung, breast, kidney, ovary, prostate and colon. In hepatocellular carcinomas, expressed in tumo
• Sequence:

  MGLGRVLLFLAVAFPFAPPAAAAEPHSLRYNLMVLSQDGSVQSGFLAEGHLDGQPFLRYD
  RQKRRAKPQGQWAENVLGAKTWDTETEDLTENGQDLRRTLTHIKDQKGGLHSLQEIRVCE
  IHEDSSTRGSRHFYYDGELFLSQNLETQESTVPQSSRAQTLAMNVTNFWKEDAMKTKTHY
  RAMQADCLQKLQRYLKSGVAIRRTVPPMVNVTCSEVSEGNITVTCRASSFYPRNITLTWR
  QDGVSLSHNTQQWGDVLPDGNGTYQTWVATRIRQGEEQRFTCYMEHSGNHGTHPVPSGKA
  LVLQSQRTDFPYVSAAMPCFVIIIILCVPCCKKKTSAAEGPELVSLQVLDQHPVGTGDHR
  DAAQLGFQPLMSATGSTGSTEGT

• Sequence length: 383

Pathways

KEGG:

Natural killer cell mediated cytotoxicity
Kaposi sarcoma-associated herpesvirus infection

Reactome:

Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BENIGN NEOPLASM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC INTERSTITIAL CYSTITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DENTAL CARIES	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IRRITABLE BOWEL SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MICROSCOPIC COLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MUCOCUTANEOUS LYMPH NODE SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOSITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STEVENS-JOHNSON SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOXIC EPIDERMAL NECROLYSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer Disease	Alzheimer disease	Pubtator	31504236	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	37741520	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	12022360		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	16776673		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	GWASCAT_DG	29273806, 31619474		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune disease	Pubtator	17557375, 19662431, 26569110, 36958849	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	19662431		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	25827949		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	35437997	Associate	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	16101830, 9712354		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	GWASDB_DG	23001997		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	22301547		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	22301547, 27026046, 31603112, 40108523	Associate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	16698444		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	18505429		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervix carcinoma	Cervix carcinoma	BEFREE	18505429		★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	GWASCAT_DG	31619474		★☆☆☆☆ Found in Text Mining only
Childhood Ataxia with Central Nervous System Hypomyelinization	Leukoencephalopathy with vanishing white matter	BEFREE	25827949		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	21388352		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	19662431	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	19353249		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	19353249, 32306128, 36958849, 38049731	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Coronary Aneurysm	BEFREE	21815799		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	11782275, 28684217		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	28684217	Associate	★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	23536857		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	39447013	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	GWASDB_DG	17632545		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	18332098		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	37492198	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Eosinophilia	Pubtator	29691386, 35437997	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	25549595	Associate	★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type IV	Glycogen storage disease	Pubtator	32306128	Associate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	32286503	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	22286212	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	GWASDB_DG	24149102		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	29693186	Inhibit	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	11782275, 19230040		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	19230040	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	36451838	Associate	★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	BEFREE	16923796		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	21477352	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12569559, 16024634, 21744989, 21873167, 24359553, 28550492		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	24359553		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	37307368	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	37679517	Inhibit	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	19851445, 27433477, 34012432	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	23084292, 27433477, 29078849		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASDB_DG	24871463		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	GWASCAT_DG	31619474		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of breast	Breast Cancer	BEFREE	22301547		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	24885711		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	26708143		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17565371, 18505429, 22915757, 25426550, 28850101		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	18505429		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	30451786		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	21815799		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	LHGDN	15304008		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	19748980, 34482362, 37460534	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	26071561, 31125275		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	LHGDN	18486757, 18588574		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	BEFREE	22184268, 31321514		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	22184268, 36548255	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myasthenia Gravis	Myasthenia Gravis	GWASDB_DG	23055271		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	17341666	Associate	★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	GWASCAT_DG	26291516		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	12714493, 15548365, 17181741, 21626162, 21805029, 23403007, 23917076, 25393367, 26708143, 27609189, 28334733, 30646520		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	36521927	Associate	★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	25363527		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	22923031, 22992985		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	30926680	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	24885711		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	31504236	Associate	★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	11584356		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	37307368	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	11170743, 16720219, 29665245		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	GWASDB_DG	19503088		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	17561376, 31504236		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	17561376		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	17561376		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	31504236	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	36482464	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sepsis	Sepsis	Pubtator	28628607	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	17181741		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	29683892		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	19414815	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	26708143		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26708143	Associate	★☆☆☆☆ Found in Text Mining only
Takayasu Arteritis	Takayasu Arteritis	BEFREE	16720219		★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	26113176		★☆☆☆☆ Found in Text Mining only
Thymus Hyperplasia	Thymus Hyperplasia	BEFREE	26113176		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	11782275, 16679067, 19662431		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	LHGDN	16679067		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	18505429, 21477352	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	15381927	Inhibit	★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	31877315	Associate	★☆☆☆☆ Found in Text Mining only