MGST1 (microsomal glutathione S-transferase 1)

Gene

• Entrez ID: 4257
• Gene name: Microsomal glutathione S-transferase 1
• Gene symbol: MGST1
• Synonyms (NCBI Gene): GST12, MGST, MGST-I, PMAN
• Chromosome: 12
• Chromosome location: 12p12.3
• Summary: The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family consists of six human proteins, two of which are involved in the production of leukotrienes and prostaglandin E, important mediators of inflammation. Other family mem

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT027876	hsa-miR-96-5p	Sequencing	20371350
MIRT039484	hsa-miR-652-3p	CLASH	23622248
MIRT1147653	hsa-miR-1257	CLIP-seq
MIRT1147654	hsa-miR-1294	CLIP-seq
MIRT1147655	hsa-miR-147	CLIP-seq
MIRT1147656	hsa-miR-182	CLIP-seq
MIRT1147657	hsa-miR-214	CLIP-seq
MIRT1147658	hsa-miR-299-5p	CLIP-seq
MIRT1147659	hsa-miR-3609	CLIP-seq
MIRT1147660	hsa-miR-3619-5p	CLIP-seq
MIRT1147661	hsa-miR-4272	CLIP-seq
MIRT1147662	hsa-miR-4291	CLIP-seq
MIRT1147663	hsa-miR-4506	CLIP-seq
MIRT1147664	hsa-miR-4667-3p	CLIP-seq
MIRT1147665	hsa-miR-4698	CLIP-seq
MIRT1147666	hsa-miR-4700-3p	CLIP-seq
MIRT1147667	hsa-miR-548ah	CLIP-seq
MIRT1147668	hsa-miR-548t	CLIP-seq
MIRT1147669	hsa-miR-629	CLIP-seq
MIRT1147670	hsa-miR-654-3p	CLIP-seq
MIRT1147671	hsa-miR-761	CLIP-seq
MIRT1147672	hsa-miR-767-3p	CLIP-seq
MIRT1147673	hsa-miR-922	CLIP-seq
MIRT1147653	hsa-miR-1257	CLIP-seq
MIRT1147654	hsa-miR-1294	CLIP-seq
MIRT1147655	hsa-miR-147	CLIP-seq
MIRT1147674	hsa-miR-203	CLIP-seq
MIRT1147657	hsa-miR-214	CLIP-seq
MIRT1147659	hsa-miR-3609	CLIP-seq
MIRT1147660	hsa-miR-3619-5p	CLIP-seq
MIRT1147662	hsa-miR-4291	CLIP-seq
MIRT1147675	hsa-miR-4464	CLIP-seq
MIRT1147676	hsa-miR-4748	CLIP-seq
MIRT1147677	hsa-miR-520d-5p	CLIP-seq
MIRT1147678	hsa-miR-524-5p	CLIP-seq
MIRT1147667	hsa-miR-548ah	CLIP-seq
MIRT1147668	hsa-miR-548t	CLIP-seq
MIRT1147670	hsa-miR-654-3p	CLIP-seq
MIRT1147671	hsa-miR-761	CLIP-seq
MIRT1147673	hsa-miR-922	CLIP-seq
MIRT2042046	hsa-miR-548k	CLIP-seq
MIRT2271735	hsa-miR-1243	CLIP-seq
MIRT1147653	hsa-miR-1257	CLIP-seq
MIRT1147654	hsa-miR-1294	CLIP-seq
MIRT2271736	hsa-miR-1324	CLIP-seq
MIRT1147655	hsa-miR-147	CLIP-seq
MIRT1147656	hsa-miR-182	CLIP-seq
MIRT1147674	hsa-miR-203	CLIP-seq
MIRT1147657	hsa-miR-214	CLIP-seq
MIRT2271737	hsa-miR-219-1-3p	CLIP-seq
MIRT2271738	hsa-miR-297	CLIP-seq
MIRT1147658	hsa-miR-299-5p	CLIP-seq
MIRT2271739	hsa-miR-3149	CLIP-seq
MIRT1147659	hsa-miR-3609	CLIP-seq
MIRT1147660	hsa-miR-3619-5p	CLIP-seq
MIRT2271740	hsa-miR-3653	CLIP-seq
MIRT2271741	hsa-miR-3658	CLIP-seq
MIRT2271742	hsa-miR-4263	CLIP-seq
MIRT1147662	hsa-miR-4291	CLIP-seq
MIRT1147675	hsa-miR-4464	CLIP-seq
MIRT2271743	hsa-miR-4495	CLIP-seq
MIRT1147663	hsa-miR-4506	CLIP-seq
MIRT2271744	hsa-miR-4663	CLIP-seq
MIRT1147664	hsa-miR-4667-3p	CLIP-seq
MIRT2271745	hsa-miR-4682	CLIP-seq
MIRT1147665	hsa-miR-4698	CLIP-seq
MIRT1147666	hsa-miR-4700-3p	CLIP-seq
MIRT2271746	hsa-miR-4728-3p	CLIP-seq
MIRT1147676	hsa-miR-4748	CLIP-seq
MIRT2271747	hsa-miR-513a-3p	CLIP-seq
MIRT1147677	hsa-miR-520d-5p	CLIP-seq
MIRT1147678	hsa-miR-524-5p	CLIP-seq
MIRT1147667	hsa-miR-548ah	CLIP-seq
MIRT1147668	hsa-miR-548t	CLIP-seq
MIRT2271748	hsa-miR-548u	CLIP-seq
MIRT2271749	hsa-miR-571	CLIP-seq
MIRT2271750	hsa-miR-576-5p	CLIP-seq
MIRT1147669	hsa-miR-629	CLIP-seq
MIRT1147670	hsa-miR-654-3p	CLIP-seq
MIRT1147671	hsa-miR-761	CLIP-seq
MIRT1147672	hsa-miR-767-3p	CLIP-seq
MIRT1147673	hsa-miR-922	CLIP-seq
MIRT2271743	hsa-miR-4495	CLIP-seq
MIRT1147666	hsa-miR-4700-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004364	Function	Glutathione transferase activity	IBA
GO:0004364	Function	Glutathione transferase activity	IDA	20727966
GO:0004364	Function	Glutathione transferase activity	IEA
GO:0004602	Function	Glutathione peroxidase activity	IDA	20727966
GO:0004602	Function	Glutathione peroxidase activity	IEA
GO:0005515	Function	Protein binding	IPI	20195357, 32296183
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IDA	20727966
GO:0005739	Component	Mitochondrion	IEA
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0005778	Component	Peroxisomal membrane	ISS
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005783	Component	Endoplasmic reticulum	ISS
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005886	Component	Plasma membrane	TAS
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	ISS
GO:0016740	Function	Transferase activity	IEA
GO:0034635	Process	Glutathione transport	IDA	20727966
GO:0035577	Component	Azurophil granule membrane	TAS
GO:0071449	Process	Cellular response to lipid hydroperoxide	IDA	20727966
GO:0098869	Process	Cellular oxidant detoxification	IEA

Other IDs

• MIM: 138330
• HGNC: 7061
• e!Ensembl: ENSG00000008394

Protein

• UniProt ID: P10620
• Protein name: Microsomal glutathione S-transferase 1 (Microsomal GST-1) (EC 2.5.1.18) (Microsomal GST-I)
• Protein function: Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01124	MAPEG	16 → 150	MAPEG family	Family

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in liver. {ECO:0000269|PubMed:3372534}.
• Sequence:

  MVDLTQVMDDEVFMAFASYATIILSKMMLMSTATAFYRLTRKVFANPEDCVAFGKGENAK
  KYLRTDDRVERVRRAHLNDLENIIPFLGIGLLYSLSGPDPSTAILHFRLFVGARIYHTIA
  YLTPLPQPNRALSFFVGYGVTLSMAYRLLKSKLYL

• Sequence length: 155

Pathways

KEGG:

Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Platinum drug resistance
Pathways in cancer
Chemical carcinogenesis - DNA adducts
Chemical carcinogenesis - receptor activation
Chemical carcinogenesis - reactive oxygen species
Hepatocellular carcinoma
Fluid shear stress and atherosclerosis

Reactome:

Glutathione conjugation
Aflatoxin activation and detoxification
Neutrophil degranulation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BARRETT'S ESOPHAGUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BELL'S PALSY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEGENERATIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL ADENOCARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LARGE ARTERY STROKE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METASTATIC COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEGENERATIVE DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEGENERATIVE DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary disease, chronic obstructive, susceptibility to	association; protective	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOURETTE SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	31707341		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	16384981		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	27486097		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	27486097	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	24486338	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	26091520	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	17483957		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23314968	Associate	★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	BEFREE	28264803		★☆☆☆☆ Found in Text Mining only
Conotruncal cardiac defects	Conotruncal cardiac defect	Pubtator	31851787	Associate	★☆☆☆☆ Found in Text Mining only
Conotruncal defect	Conotruncal defect	BEFREE	31851787		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	35872023	Stimulate	★☆☆☆☆ Found in Text Mining only
Degenerative Diseases, Central Nervous System	Degenerative Diseases, Central Nervous System	CTD_human_DG	15964507		★☆☆☆☆ Found in Text Mining only
Degenerative Diseases, Spinal Cord	Degenerative Diseases, Central Nervous System	CTD_human_DG	15964507		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	35898457	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	35218676	Associate	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	19307502		★☆☆☆☆ Found in Text Mining only
Exfoliation Syndrome	Exfoliation Syndrome	BEFREE	23805041, 28450942		★☆☆☆☆ Found in Text Mining only
Gastritis Atrophic	Gastritis	Pubtator	23801863	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	23801863		★☆☆☆☆ Found in Text Mining only
Gilles de la Tourette syndrome	Tourette Syndrome	GWASCAT_DG	30818990		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	24466029		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	24466029	Associate	★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	28264803	Associate	★☆☆☆☆ Found in Text Mining only
hereditary neuroblastoma	Neuroblastoma	BEFREE	24486338		★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Hereditary Pancreatitis	BEFREE	15338373		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	35409356	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	23801863	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal neoplasm	Laryngeal neoplasm	LHGDN	12359356		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	38186215	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	15645424		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	19887610	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	27067838		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	29695404		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	27067838		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	27067838	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15645424, 24486338, 31707341		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	24486338		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	24486338	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	CTD_human_DG	15964507		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	34143955	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	38169383	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	32460521	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	12532421		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	37161854	Associate	★☆☆☆☆ Found in Text Mining only