MFGE8 (milk fat globule EGF and factor V/VIII domain containing)

Gene

• Entrez ID: 4240
• Gene name: Milk fat globule EGF and factor V/VIII domain containing
• Gene symbol: MFGE8
• Synonyms (NCBI Gene): BA46, EDIL1, HMFG, HsT19888, MFG-E8, MFGM, OAcGD3S, SED1, SPAG10, hP47
• Chromosome: 15
• Chromosome location: 15q26.1
• Summary: This gene encodes a preproprotein that is proteolytically processed to form multiple protein products. The major encoded protein product, lactadherin, is a membrane glycoprotein that promotes phagocytosis of apoptotic cells. This protein has also been imp

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017018	hsa-miR-335-5p	Microarray	18185580
MIRT038170	hsa-miR-423-5p	CLASH	23622248
MIRT1551273	hsa-miR-1	CLIP-seq
MIRT1551274	hsa-miR-1207-5p	CLIP-seq
MIRT1551275	hsa-miR-185	CLIP-seq
MIRT1551276	hsa-miR-206	CLIP-seq
MIRT1551277	hsa-miR-3184	CLIP-seq
MIRT1551278	hsa-miR-3661	CLIP-seq
MIRT1551279	hsa-miR-3665	CLIP-seq
MIRT1551280	hsa-miR-4306	CLIP-seq
MIRT1551281	hsa-miR-4489	CLIP-seq
MIRT1551282	hsa-miR-4644	CLIP-seq
MIRT1551283	hsa-miR-4651	CLIP-seq
MIRT1551284	hsa-miR-4736	CLIP-seq
MIRT1551285	hsa-miR-4763-3p	CLIP-seq
MIRT1551286	hsa-miR-608	CLIP-seq
MIRT1551287	hsa-miR-613	CLIP-seq
MIRT1551288	hsa-miR-631	CLIP-seq
MIRT1551289	hsa-miR-637	CLIP-seq
MIRT1551290	hsa-miR-7	CLIP-seq
MIRT1551283	hsa-miR-4651	CLIP-seq
MIRT1551286	hsa-miR-608	CLIP-seq
MIRT1551289	hsa-miR-637	CLIP-seq
MIRT1551274	hsa-miR-1207-5p	CLIP-seq
MIRT2570290	hsa-miR-1224-5p	CLIP-seq
MIRT2570291	hsa-miR-148a	CLIP-seq
MIRT2570292	hsa-miR-148b	CLIP-seq
MIRT2570293	hsa-miR-152	CLIP-seq
MIRT2570294	hsa-miR-3074-5p	CLIP-seq
MIRT2570295	hsa-miR-3124-3p	CLIP-seq
MIRT2570296	hsa-miR-3157-3p	CLIP-seq
MIRT2570297	hsa-miR-3169	CLIP-seq
MIRT2570298	hsa-miR-3191	CLIP-seq
MIRT2570299	hsa-miR-4278	CLIP-seq
MIRT2570300	hsa-miR-4330	CLIP-seq
MIRT2570301	hsa-miR-4421	CLIP-seq
MIRT2570302	hsa-miR-4436a	CLIP-seq
MIRT2570303	hsa-miR-4515	CLIP-seq
MIRT2570304	hsa-miR-4700-3p	CLIP-seq
MIRT2570305	hsa-miR-4751	CLIP-seq
MIRT1551285	hsa-miR-4763-3p	CLIP-seq
MIRT2570306	hsa-miR-510	CLIP-seq
MIRT2570307	hsa-miR-512-5p	CLIP-seq
MIRT2570308	hsa-miR-515-3p	CLIP-seq
MIRT2570309	hsa-miR-519e	CLIP-seq
MIRT2570310	hsa-miR-570	CLIP-seq
MIRT1551289	hsa-miR-637	CLIP-seq
MIRT2570311	hsa-miR-874	CLIP-seq
MIRT2570312	hsa-miR-938	CLIP-seq
MIRT1551274	hsa-miR-1207-5p	CLIP-seq
MIRT2570290	hsa-miR-1224-5p	CLIP-seq
MIRT2570291	hsa-miR-148a	CLIP-seq
MIRT2570292	hsa-miR-148b	CLIP-seq
MIRT2570293	hsa-miR-152	CLIP-seq
MIRT2570294	hsa-miR-3074-5p	CLIP-seq
MIRT2570295	hsa-miR-3124-3p	CLIP-seq
MIRT2570296	hsa-miR-3157-3p	CLIP-seq
MIRT2570297	hsa-miR-3169	CLIP-seq
MIRT2570299	hsa-miR-4278	CLIP-seq
MIRT2570300	hsa-miR-4330	CLIP-seq
MIRT2570301	hsa-miR-4421	CLIP-seq
MIRT2570302	hsa-miR-4436a	CLIP-seq
MIRT2570303	hsa-miR-4515	CLIP-seq
MIRT2570304	hsa-miR-4700-3p	CLIP-seq
MIRT2570305	hsa-miR-4751	CLIP-seq
MIRT1551285	hsa-miR-4763-3p	CLIP-seq
MIRT2570306	hsa-miR-510	CLIP-seq
MIRT2570307	hsa-miR-512-5p	CLIP-seq
MIRT2570308	hsa-miR-515-3p	CLIP-seq
MIRT2570309	hsa-miR-519e	CLIP-seq
MIRT2570310	hsa-miR-570	CLIP-seq
MIRT1551289	hsa-miR-637	CLIP-seq
MIRT2570311	hsa-miR-874	CLIP-seq
MIRT2570312	hsa-miR-938	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0001786	Function	Phosphatidylserine binding	IBA
GO:0001786	Function	Phosphatidylserine binding	IPI	21196491
GO:0002080	Component	Acrosomal membrane	IEA
GO:0005178	Function	Integrin binding	IEA
GO:0005201	Function	Extracellular matrix structural constituent	RCA	20551380, 27068509, 27559042, 28327460
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0007155	Process	Cell adhesion	IEA
GO:0007338	Process	Single fertilization	IEA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0031012	Component	Extracellular matrix	HDA	20551380
GO:0031012	Component	Extracellular matrix	HDA	27068509, 27559042, 28327460
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0043277	Process	Apoptotic cell clearance	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 19199708, 20458337, 21362503
GO:1903561	Component	Extracellular vesicle	HDA	24769233

Other IDs

• MIM: 602281
• HGNC: 7036
• e!Ensembl: ENSG00000140545

Protein

• UniProt ID: Q08431
• Protein name: Lactadherin (Breast epithelial antigen BA46) (HMFG) (MFGM) (Milk fat globule-EGF factor 8) (MFG-E8) (SED1) [Cleaved into: Lactadherin short form; Medin]
• Protein function: Plays an important role in the maintenance of intestinal epithelial homeostasis and the promotion of mucosal healing. Promotes VEGF-dependent neovascularization (By similarity). Contributes to phagocytic removal of apoptotic cells in many tissue
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00008	EGF	27 → 65	EGF-like domain	Domain
  PF00754	F5_F8_type_C	85 → 222	F5/8 type C domain	Domain
  PF00754	F5_F8_type_C	245 → 384	F5/8 type C domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Mammary epithelial cell surfaces and aortic media. Overexpressed in several carcinomas.
• Sequence:

  MPRPRLLAALCGALLCAPSLLVALDICSKNPCHNGGLCEEISQEVRGDVFPSYTCTCLKG
  YAGNHCETKCVEPLGLENGNIANSQIAASSVRVTFLGLQHWVPELARLNRAGMVNAWTPS
  SNDDNPWIQVNLLRRMWVTGVVTQGASRLASHEYLKAFKVAYSLNGHEFDFIHDVNKKHK
  EFVGNWNKNAVHVNLFETPVEAQYVRLYPTSCHTACTLRFELLGCELNGCANPLGLKNNS
  IPDKQITASSSYKTWGLHLFSWNPSYARLDKQGNFNAWVAGSYGNDQWLQVDLGSSKEVT
  GIITQGARNFGSVQFVASYKVAYSNDSANWTEYQDPRTGSSKIFPGNWDNHSHKKNLFET
  PILARYVRILPVAWHNRIALRLELLGC

• Sequence length: 387

Pathways

KEGG:

Efferocytosis

Reactome:

Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
Post-translational protein phosphorylation
Amyloid fiber formation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GIANT CELL ARTERITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Age related macular degeneration	Age-related macular degeneration	BEFREE	22438901		★☆☆☆☆ Found in Text Mining only
Aggressive Systemic Mastocytosis	Systemic Mastocytosis	BEFREE	23269839		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	25614623, 37914766	Associate	★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	31436032		★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	16154850		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	22797469	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	17420351, 29152651, 29879884, 30861420		★☆☆☆☆ Found in Text Mining only
Arthritis Infectious	Infective arthritis	Pubtator	23324439	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	23269839		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	17420351, 29152651, 29879884, 30861420		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	30861420	Associate	★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	26206710		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	18180767, 26922658		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	20213738, 22723547, 22761839, 30286201, 31766264		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	16631355		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	16631355		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	BEFREE	20956946		★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood Coagulation Disorders	BEFREE	29162596		★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	35005020	Associate	★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	BEFREE	29453194		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10821695, 12189239, 15565181, 17637751, 21127199, 30612778, 30867784		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	21127199		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	37704733	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinogenesis	Carcinogenesis	Pubtator	36484512	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	17637751, 20956946		★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	37975220	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	20956946		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	31899997	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	33893076	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	25264705	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	28827473		★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	35440618	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	30154436		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	31213977		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	28266034		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	28195210		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	22204000	Inhibit	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28653875, 28923329		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25081869	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28653875	Stimulate	★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	30861420		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	30861420		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	30861420	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	40413414	Inhibit	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	30861420		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	29775413, 30349851		★☆☆☆☆ Found in Text Mining only
Dementia Vascular	Vascular dementia	Pubtator	37914766	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	27194784		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	27194784		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	37933040	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	30447538		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	37933040	Inhibit	★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	15565181		★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	21127199		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	36659830	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	28967712	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	30156356		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	30156356		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	12670504, 27956229, 28115038		★☆☆☆☆ Found in Text Mining only
Frontotemporal Lobar Degeneration	Frontotemporal dementia	BEFREE	30349851		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	11748647		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	31071304		★☆☆☆☆ Found in Text Mining only
Glycogen storage disease type II	Glycogen Storage Disease	BEFREE	22438901		★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type IV	Glycogen storage disease	Pubtator	26375445	Inhibit	★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	BEFREE	31447183		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	36484512	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	27194784		★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	28967712	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	31811237	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	37933040	Inhibit	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	28601327		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31673081		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	31673081		★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	40140823	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	27768123		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	31811237	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	27768123		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	18303131, 19502262, 20213738, 23832117, 27768123, 28266034, 31811237		★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	27768123		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	28653875	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15565181, 17637751, 21127199, 30612778, 30867784		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	21127199		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	30156356		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17637751, 20956946, 22761839, 24505114, 25081869, 28653875, 30724237		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	21127199		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	12189239, 21127199		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	21127199		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	21127199		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	18974133		★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	29775413		★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis I	Mucopolysaccharidosis	Pubtator	32880920	Associate	★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	31265168		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	20956946, 21746895, 27866791, 28653875, 28923329, 30156356, 31447183		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	18670887		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	18670887, 30154436, 31213977		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	24958900, 29475373		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	20132413, 31899997	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	36484512	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	38431242	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	23324439	Stimulate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	30200351, 31213977		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	30903320		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	24958900		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	18690294		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	29775413, 30349851		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	26375445	Inhibit	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	30100715	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	26055407	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcopenia	Sarcopenia	Pubtator	38644354	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	15923110, 16631355, 17464717, 19411161, 21642896, 29759351, 30786269		★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	37774691	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	20882259, 21874225, 28096298, 28601327, 31747882		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	17637751		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	30156356		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	25264705, 31256324	Associate	★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	30175895		★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	30134156		★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	31442368		★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	BEFREE	31442368		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	34814333	Associate	★☆☆☆☆ Found in Text Mining only
Trigeminal Neuralgia	Trigeminal neuralgia	Pubtator	39361088	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	21127199		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	32591639	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Calcification	Vascular calcification	Pubtator	35440618	Stimulate	★☆☆☆☆ Found in Text Mining only