Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	4239
Gene name	Microfibril associated protein 4
Gene symbol	MFAP4
Synonyms (NCBI Gene)	-
Chromosome	17
Chromosome location	17p11.2
Summary	This gene encodes a protein with similarity to a bovine microfibril-associated protein. The protein has binding specificities for both collagen and carbohydrate. It is thought to be an extracellular matrix protein which is involved in cell adhesion or int

264

Show/Hide all (264)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022137	hsa-miR-124-3p	Microarray	18668037
MIRT1146009	hsa-miR-1587	CLIP-seq
MIRT1146010	hsa-miR-378g	CLIP-seq
MIRT1146011	hsa-miR-4492	CLIP-seq
MIRT1146012	hsa-miR-4498	CLIP-seq
MIRT1146013	hsa-miR-4656	CLIP-seq
MIRT1146014	hsa-miR-4675	CLIP-seq
MIRT1146015	hsa-miR-4690-3p	CLIP-seq
MIRT1146016	hsa-miR-4731-5p	CLIP-seq
MIRT1146017	hsa-miR-4741	CLIP-seq
MIRT1146018	hsa-miR-512-3p	CLIP-seq
MIRT1146019	hsa-miR-762	CLIP-seq
MIRT2041515	hsa-miR-1912	CLIP-seq
MIRT2041516	hsa-miR-2110	CLIP-seq
MIRT2041517	hsa-miR-3675-5p	CLIP-seq
MIRT2041518	hsa-miR-4271	CLIP-seq
MIRT2041519	hsa-miR-4725-3p	CLIP-seq
MIRT2041520	hsa-miR-7	CLIP-seq
MIRT2041521	hsa-miR-767-3p	CLIP-seq
MIRT2390846	hsa-miR-4645-5p	CLIP-seq
MIRT2390847	hsa-miR-4673	CLIP-seq
MIRT2431105	hsa-miR-3173-3p	CLIP-seq
MIRT2431106	hsa-miR-764	CLIP-seq
MIRT2431107	hsa-miR-765	CLIP-seq
MIRT2431108	hsa-miR-939	CLIP-seq
MIRT2570181	hsa-miR-1184	CLIP-seq
MIRT2570182	hsa-miR-1207-3p	CLIP-seq
MIRT2570183	hsa-miR-128	CLIP-seq
MIRT2570184	hsa-miR-1286	CLIP-seq
MIRT2570185	hsa-miR-1293	CLIP-seq
MIRT2570186	hsa-miR-1301	CLIP-seq
MIRT2570187	hsa-miR-1302	CLIP-seq
MIRT2570188	hsa-miR-1324	CLIP-seq
MIRT2570189	hsa-miR-146b-3p	CLIP-seq
MIRT2570190	hsa-miR-147b	CLIP-seq
MIRT2570191	hsa-miR-1910	CLIP-seq
MIRT2570192	hsa-miR-2114	CLIP-seq
MIRT2570193	hsa-miR-2116	CLIP-seq
MIRT2570194	hsa-miR-214	CLIP-seq
MIRT2570195	hsa-miR-219-5p	CLIP-seq
MIRT2570196	hsa-miR-2355-3p	CLIP-seq
MIRT2570197	hsa-miR-2467-3p	CLIP-seq
MIRT2570198	hsa-miR-298	CLIP-seq
MIRT2570199	hsa-miR-3064-5p	CLIP-seq
MIRT2570200	hsa-miR-3122	CLIP-seq
MIRT2570201	hsa-miR-3127-5p	CLIP-seq
MIRT2570202	hsa-miR-3136-3p	CLIP-seq
MIRT2570203	hsa-miR-3147	CLIP-seq
MIRT2570204	hsa-miR-3158-5p	CLIP-seq
MIRT2570205	hsa-miR-3162-3p	CLIP-seq
MIRT2431105	hsa-miR-3173-3p	CLIP-seq
MIRT2570206	hsa-miR-3173-5p	CLIP-seq
MIRT2570207	hsa-miR-3192	CLIP-seq
MIRT2570208	hsa-miR-3198	CLIP-seq
MIRT2570209	hsa-miR-3607-5p	CLIP-seq
MIRT2570210	hsa-miR-3612	CLIP-seq
MIRT2570211	hsa-miR-3619-3p	CLIP-seq
MIRT2570212	hsa-miR-3619-5p	CLIP-seq
MIRT2570213	hsa-miR-3650	CLIP-seq
MIRT2570214	hsa-miR-3678-3p	CLIP-seq
MIRT2570215	hsa-miR-3907	CLIP-seq
MIRT2570216	hsa-miR-3909	CLIP-seq
MIRT2570217	hsa-miR-3913-5p	CLIP-seq
MIRT2570218	hsa-miR-3915	CLIP-seq
MIRT2570219	hsa-miR-3922-5p	CLIP-seq
MIRT2570220	hsa-miR-3928	CLIP-seq
MIRT2570221	hsa-miR-3934	CLIP-seq
MIRT2570222	hsa-miR-423-3p	CLIP-seq
MIRT2041518	hsa-miR-4271	CLIP-seq
MIRT2570223	hsa-miR-4291	CLIP-seq
MIRT2570224	hsa-miR-4298	CLIP-seq
MIRT2570225	hsa-miR-4309	CLIP-seq
MIRT2570226	hsa-miR-4313	CLIP-seq
MIRT2570227	hsa-miR-4425	CLIP-seq
MIRT2570228	hsa-miR-4426	CLIP-seq
MIRT2570229	hsa-miR-4428	CLIP-seq
MIRT2570230	hsa-miR-4436a	CLIP-seq
MIRT2570231	hsa-miR-4443	CLIP-seq
MIRT2570232	hsa-miR-4457	CLIP-seq
MIRT2570233	hsa-miR-4469	CLIP-seq
MIRT2570234	hsa-miR-4474-3p	CLIP-seq
MIRT2570235	hsa-miR-4483	CLIP-seq
MIRT1146011	hsa-miR-4492	CLIP-seq
MIRT1146012	hsa-miR-4498	CLIP-seq
MIRT2570236	hsa-miR-4505	CLIP-seq
MIRT2570237	hsa-miR-4529-5p	CLIP-seq
MIRT2570238	hsa-miR-455-3p	CLIP-seq
MIRT2570239	hsa-miR-4640-5p	CLIP-seq
MIRT2570240	hsa-miR-4642	CLIP-seq
MIRT2570241	hsa-miR-4647	CLIP-seq
MIRT2570242	hsa-miR-4653-3p	CLIP-seq
MIRT2570243	hsa-miR-4660	CLIP-seq
MIRT2570244	hsa-miR-4662b	CLIP-seq
MIRT2570245	hsa-miR-4677-5p	CLIP-seq
MIRT2570246	hsa-miR-4687-3p	CLIP-seq
MIRT2570247	hsa-miR-4693-3p	CLIP-seq
MIRT2570248	hsa-miR-4704-5p	CLIP-seq
MIRT2041519	hsa-miR-4725-3p	CLIP-seq
MIRT2570249	hsa-miR-4726-5p	CLIP-seq
MIRT2570250	hsa-miR-4756-3p	CLIP-seq
MIRT2570251	hsa-miR-4775	CLIP-seq
MIRT2570252	hsa-miR-4776-5p	CLIP-seq
MIRT2570253	hsa-miR-4782-3p	CLIP-seq
MIRT2570254	hsa-miR-4786-5p	CLIP-seq
MIRT2570255	hsa-miR-4793-3p	CLIP-seq
MIRT2570256	hsa-miR-490-5p	CLIP-seq
MIRT2570257	hsa-miR-5047	CLIP-seq
MIRT2570258	hsa-miR-508-5p	CLIP-seq
MIRT2570259	hsa-miR-571	CLIP-seq
MIRT2570260	hsa-miR-590-3p	CLIP-seq
MIRT2570261	hsa-miR-615-5p	CLIP-seq
MIRT2570262	hsa-miR-650	CLIP-seq
MIRT2570263	hsa-miR-663b	CLIP-seq
MIRT2570264	hsa-miR-676	CLIP-seq
MIRT2570265	hsa-miR-761	CLIP-seq
MIRT1146019	hsa-miR-762	CLIP-seq
MIRT2041521	hsa-miR-767-3p	CLIP-seq
MIRT2570266	hsa-miR-769-5p	CLIP-seq
MIRT2570267	hsa-miR-922	CLIP-seq
MIRT2570181	hsa-miR-1184	CLIP-seq
MIRT2570182	hsa-miR-1207-3p	CLIP-seq
MIRT2570183	hsa-miR-128	CLIP-seq
MIRT2570184	hsa-miR-1286	CLIP-seq
MIRT2684900	hsa-miR-1291	CLIP-seq
MIRT2570185	hsa-miR-1293	CLIP-seq
MIRT2684901	hsa-miR-1294	CLIP-seq
MIRT2570186	hsa-miR-1301	CLIP-seq
MIRT2570187	hsa-miR-1302	CLIP-seq
MIRT2570188	hsa-miR-1324	CLIP-seq
MIRT2684902	hsa-miR-140-3p	CLIP-seq
MIRT2570189	hsa-miR-146b-3p	CLIP-seq
MIRT2570190	hsa-miR-147b	CLIP-seq
MIRT1146009	hsa-miR-1587	CLIP-seq
MIRT2570191	hsa-miR-1910	CLIP-seq
MIRT2041515	hsa-miR-1912	CLIP-seq
MIRT2684903	hsa-miR-197	CLIP-seq
MIRT2041516	hsa-miR-2110	CLIP-seq
MIRT2570192	hsa-miR-2114	CLIP-seq
MIRT2570193	hsa-miR-2116	CLIP-seq
MIRT2570194	hsa-miR-214	CLIP-seq
MIRT2570195	hsa-miR-219-5p	CLIP-seq
MIRT2684904	hsa-miR-2278	CLIP-seq
MIRT2570196	hsa-miR-2355-3p	CLIP-seq
MIRT2570197	hsa-miR-2467-3p	CLIP-seq
MIRT2684905	hsa-miR-296-5p	CLIP-seq
MIRT2570198	hsa-miR-298	CLIP-seq
MIRT2570199	hsa-miR-3064-5p	CLIP-seq
MIRT2570200	hsa-miR-3122	CLIP-seq
MIRT2570201	hsa-miR-3127-5p	CLIP-seq
MIRT2570202	hsa-miR-3136-3p	CLIP-seq
MIRT2570203	hsa-miR-3147	CLIP-seq
MIRT2570204	hsa-miR-3158-5p	CLIP-seq
MIRT2570205	hsa-miR-3162-3p	CLIP-seq
MIRT2684906	hsa-miR-3170	CLIP-seq
MIRT2431105	hsa-miR-3173-3p	CLIP-seq
MIRT2570206	hsa-miR-3173-5p	CLIP-seq
MIRT2684907	hsa-miR-3174	CLIP-seq
MIRT2570207	hsa-miR-3192	CLIP-seq
MIRT2570208	hsa-miR-3198	CLIP-seq
MIRT2684908	hsa-miR-3200-3p	CLIP-seq
MIRT2570209	hsa-miR-3607-5p	CLIP-seq
MIRT2570210	hsa-miR-3612	CLIP-seq
MIRT2684909	hsa-miR-3615	CLIP-seq
MIRT2570211	hsa-miR-3619-3p	CLIP-seq
MIRT2570212	hsa-miR-3619-5p	CLIP-seq
MIRT2684910	hsa-miR-3622b-5p	CLIP-seq
MIRT2570213	hsa-miR-3650	CLIP-seq
MIRT2041517	hsa-miR-3675-5p	CLIP-seq
MIRT2570214	hsa-miR-3678-3p	CLIP-seq
MIRT2684911	hsa-miR-3680	CLIP-seq
MIRT2684912	hsa-miR-3688-5p	CLIP-seq
MIRT2684913	hsa-miR-3689a-3p	CLIP-seq
MIRT2684914	hsa-miR-3689c	CLIP-seq
MIRT2684915	hsa-miR-377	CLIP-seq
MIRT1146010	hsa-miR-378g	CLIP-seq
MIRT2684916	hsa-miR-382	CLIP-seq
MIRT2570215	hsa-miR-3907	CLIP-seq
MIRT2570216	hsa-miR-3909	CLIP-seq
MIRT2570217	hsa-miR-3913-5p	CLIP-seq
MIRT2570218	hsa-miR-3915	CLIP-seq
MIRT2684917	hsa-miR-3917	CLIP-seq
MIRT2570219	hsa-miR-3922-5p	CLIP-seq
MIRT2570220	hsa-miR-3928	CLIP-seq
MIRT2570221	hsa-miR-3934	CLIP-seq
MIRT2570222	hsa-miR-423-3p	CLIP-seq
MIRT2041518	hsa-miR-4271	CLIP-seq
MIRT2570223	hsa-miR-4291	CLIP-seq
MIRT2570224	hsa-miR-4298	CLIP-seq
MIRT2570225	hsa-miR-4309	CLIP-seq
MIRT2570226	hsa-miR-4313	CLIP-seq
MIRT2684918	hsa-miR-4417	CLIP-seq
MIRT2684919	hsa-miR-4419a	CLIP-seq
MIRT2570227	hsa-miR-4425	CLIP-seq
MIRT2570228	hsa-miR-4426	CLIP-seq
MIRT2570229	hsa-miR-4428	CLIP-seq
MIRT2570230	hsa-miR-4436a	CLIP-seq
MIRT2570231	hsa-miR-4443	CLIP-seq
MIRT2570232	hsa-miR-4457	CLIP-seq
MIRT2570233	hsa-miR-4469	CLIP-seq
MIRT2570234	hsa-miR-4474-3p	CLIP-seq
MIRT2570235	hsa-miR-4483	CLIP-seq
MIRT1146011	hsa-miR-4492	CLIP-seq
MIRT1146012	hsa-miR-4498	CLIP-seq
MIRT2570236	hsa-miR-4505	CLIP-seq
MIRT2684920	hsa-miR-4510	CLIP-seq
MIRT2570237	hsa-miR-4529-5p	CLIP-seq
MIRT2570238	hsa-miR-455-3p	CLIP-seq
MIRT2684921	hsa-miR-455-5p	CLIP-seq
MIRT2570239	hsa-miR-4640-5p	CLIP-seq
MIRT2570240	hsa-miR-4642	CLIP-seq
MIRT2390846	hsa-miR-4645-5p	CLIP-seq
MIRT2570241	hsa-miR-4647	CLIP-seq
MIRT2570242	hsa-miR-4653-3p	CLIP-seq
MIRT1146013	hsa-miR-4656	CLIP-seq
MIRT2570243	hsa-miR-4660	CLIP-seq
MIRT2570244	hsa-miR-4662b	CLIP-seq
MIRT2390847	hsa-miR-4673	CLIP-seq
MIRT1146014	hsa-miR-4675	CLIP-seq
MIRT2570245	hsa-miR-4677-5p	CLIP-seq
MIRT2570246	hsa-miR-4687-3p	CLIP-seq
MIRT2684922	hsa-miR-4688	CLIP-seq
MIRT1146015	hsa-miR-4690-3p	CLIP-seq
MIRT2570247	hsa-miR-4693-3p	CLIP-seq
MIRT2684923	hsa-miR-4699-5p	CLIP-seq
MIRT2570248	hsa-miR-4704-5p	CLIP-seq
MIRT2684924	hsa-miR-4711-5p	CLIP-seq
MIRT2041519	hsa-miR-4725-3p	CLIP-seq
MIRT2570249	hsa-miR-4726-5p	CLIP-seq
MIRT2684925	hsa-miR-4728-3p	CLIP-seq
MIRT2684926	hsa-miR-4728-5p	CLIP-seq
MIRT1146016	hsa-miR-4731-5p	CLIP-seq
MIRT1146017	hsa-miR-4741	CLIP-seq
MIRT2570250	hsa-miR-4756-3p	CLIP-seq
MIRT2684927	hsa-miR-4764-5p	CLIP-seq
MIRT2570251	hsa-miR-4775	CLIP-seq
MIRT2570252	hsa-miR-4776-5p	CLIP-seq
MIRT2570253	hsa-miR-4782-3p	CLIP-seq
MIRT2570254	hsa-miR-4786-5p	CLIP-seq
MIRT2570255	hsa-miR-4793-3p	CLIP-seq
MIRT2684928	hsa-miR-4798-3p	CLIP-seq
MIRT2684929	hsa-miR-486-3p	CLIP-seq
MIRT2570256	hsa-miR-490-5p	CLIP-seq
MIRT2684930	hsa-miR-496	CLIP-seq
MIRT2570257	hsa-miR-5047	CLIP-seq
MIRT2570258	hsa-miR-508-5p	CLIP-seq
MIRT1146018	hsa-miR-512-3p	CLIP-seq
MIRT2684931	hsa-miR-541	CLIP-seq
MIRT2684932	hsa-miR-550a	CLIP-seq
MIRT2570259	hsa-miR-571	CLIP-seq
MIRT2684933	hsa-miR-586	CLIP-seq
MIRT2570260	hsa-miR-590-3p	CLIP-seq
MIRT2570261	hsa-miR-615-5p	CLIP-seq
MIRT2684934	hsa-miR-647	CLIP-seq
MIRT2570262	hsa-miR-650	CLIP-seq
MIRT2684935	hsa-miR-654-5p	CLIP-seq
MIRT2570263	hsa-miR-663b	CLIP-seq
MIRT2570264	hsa-miR-676	CLIP-seq
MIRT2041520	hsa-miR-7	CLIP-seq
MIRT2570265	hsa-miR-761	CLIP-seq
MIRT1146019	hsa-miR-762	CLIP-seq
MIRT2041521	hsa-miR-767-3p	CLIP-seq
MIRT2570266	hsa-miR-769-5p	CLIP-seq
MIRT2684936	hsa-miR-921	CLIP-seq
MIRT2570267	hsa-miR-922	CLIP-seq

Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001527	Component	Microfibril	IDA	22355679
GO:0001527	Component	Microfibril	NAS	7633408
GO:0005201	Function	Extracellular matrix structural constituent	RCA	20551380, 25037231, 28675934
GO:0005515	Function	Protein binding	IPI	22355679, 26601954
GO:0005576	Component	Extracellular region	HDA	27068509
GO:0005576	Component	Extracellular region	IDA	22355679
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0007155	Process	Cell adhesion	IEA
GO:0009650	Process	UV protection	IDA	22355679
GO:0010712	Process	Regulation of collagen metabolic process	IDA	22355679
GO:0031012	Component	Extracellular matrix	HDA	20551380
GO:0031012	Component	Extracellular matrix	HDA	25037231, 28675934
GO:0031012	Component	Extracellular matrix	IBA
GO:0031012	Component	Extracellular matrix	IDA	26601954
GO:0048251	Process	Elastic fiber assembly	IBA
GO:0048251	Process	Elastic fiber assembly	IDA	22355679
GO:0071493	Process	Cellular response to UV-B	IDA	22355679
GO:0071953	Component	Elastic fiber	IDA	10424889
GO:0071953	Component	Elastic fiber	IEA
GO:0097435	Process	Supramolecular fiber organization	IDA	22355679

MIM	HGNC	e!Ensembl
600596	7035	ENSG00000166482

P55083

Protein name

Microfibril-associated glycoprotein 4

Protein function

Could be involved in calcium-dependent cell adhesion or intercellular interactions. May contribute to the elastic fiber assembly and/or maintenance (PubMed:26601954).

PDB

7ZMK , 8UN7

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00147	Fibrinogen_C	37 → 255	Fibrinogen beta and gamma chains, C-terminal globular domain	Domain

Sequence

MKALLALPLLLLLSTPPCAPQVSGIRGDALERFCLQQPLDCDDIYAQGYQSDGVYLIYPS
GPSVPVPVFCDMTTEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQNMHLL
TLKQKYELRVDLEDFENNTAYAKYADFSISPNAVSAEEDGYTLFVAGFEDGGAGDSLSYH
SGQKFSTFDRDQDLFVQNCAALSSGAFWFRSCHFANLNGFYLGGSHLSYANGINWAQWKG
FYYSLKRTEMKIRRA

Sequence length

255

Interactions

View interactions

	Reactome
			Molecules associated with elastic fibres

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (48)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Aneurysm	Aneurysm	Pubtator	31315432	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	31784280	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	22226179, 31784280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Dissection	Aortic dissection	Pubtator	31315432	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthropathy	Arthropathy	BEFREE	31233243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	31110528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brachycephaly	Brachycephaly	BEFREE	17539903		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	30089404		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	38235137	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	40410886	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	38188687	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiac valvular dysplasia, X-linked	Cardiac Valvular Dysplasia , X-Linked	BEFREE	24349233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	31315432	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	24349233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	24990664		★★★★★ ★☆☆☆☆ Found in Text Mining only
Contiguous gene syndrome	Contiguous gene syndrome	BEFREE	7633408		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	31233243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating diseases	Pubtator	37830484	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	28360945	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	40640313	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	28039584		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic Nephropathy	BEFREE	28039584		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dupuytren Contracture	Dupuytren contracture	Pubtator	40243889	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	36277723	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial benign pemphigus	Benign Pemphigus	BEFREE	30506709		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	40527859	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	38225249	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	19177598, 24324779	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30089404		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26074449		★★★★★ ★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan syndrome	Pubtator	19720936	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan Syndrome	BEFREE	31315432		★★★★★ ★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan syndrome	Pubtator	31315432	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	37830484	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Neuritis	Optic neuritis	Pubtator	37830484	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral submucous fibrosis	Pubtator	34798886	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	35741755	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Paroxysmal atrial fibrillation	Paroxysmal atrial fibrillation	BEFREE	31110528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	29884190	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	29884190		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral arterial stenosis	Peripheral arterial stenosis	BEFREE	29884190		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	31233243, 31498068		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	30506709		★★★★★ ★☆☆☆☆ Found in Text Mining only
Smith-Magenis syndrome	Smith-Magenis Syndrome	BEFREE	7633408		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	34210950	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	24349233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	31233243, 31498068		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	21483740	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

MFAP4 (microfibril associated protein 4)