Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	4234
Gene name	Methyltransferase 1, tRNA methylguanosine
Gene symbol	METTL1
Synonyms (NCBI Gene)	C12orf1TRM8TRMT8YDL201w
Chromosome	12
Chromosome location	12q14.1
Summary	This gene is similar in sequence to the S. cerevisiae YDL201w gene. The gene product contains a conserved S-adenosylmethionine-binding motif and is inactivated by phosphorylation. Alternative splice variants encoding different protein isoforms have been d

Show/Hide all (77)

miRTarBase ID	miRNA	Experiments	Reference
MIRT656307	hsa-miR-136-5p	HITS-CLIP	23824327
MIRT656306	hsa-miR-1277-3p	HITS-CLIP	23824327
MIRT656305	hsa-miR-885-5p	HITS-CLIP	23824327
MIRT656303	hsa-miR-1470	HITS-CLIP	23824327
MIRT656304	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT656302	hsa-miR-204-3p	HITS-CLIP	23824327
MIRT656301	hsa-miR-4646-5p	HITS-CLIP	23824327
MIRT656300	hsa-miR-4668-5p	HITS-CLIP	23824327
MIRT656299	hsa-miR-3153	HITS-CLIP	23824327
MIRT656298	hsa-miR-6733-5p	HITS-CLIP	23824327
MIRT656296	hsa-miR-6739-5p	HITS-CLIP	23824327
MIRT656297	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT656295	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT461485	hsa-miR-3910	PAR-CLIP	23592263
MIRT461484	hsa-miR-3154	PAR-CLIP	23592263
MIRT461483	hsa-miR-2392	PAR-CLIP	23592263
MIRT461482	hsa-miR-4459	PAR-CLIP	23592263
MIRT461481	hsa-miR-605-3p	PAR-CLIP	23592263
MIRT461480	hsa-miR-5004-5p	PAR-CLIP	23592263
MIRT461479	hsa-miR-3605-5p	PAR-CLIP	23592263
MIRT461478	hsa-miR-6894-5p	PAR-CLIP	23592263
MIRT461477	hsa-miR-1193	PAR-CLIP	23592263
MIRT461476	hsa-miR-4650-3p	PAR-CLIP	23592263
MIRT461475	hsa-miR-3529-5p	PAR-CLIP	23592263
MIRT461474	hsa-miR-379-5p	PAR-CLIP	23592263
MIRT461473	hsa-miR-4451	PAR-CLIP	23592263
MIRT461472	hsa-miR-4298	PAR-CLIP	23592263
MIRT656307	hsa-miR-136-5p	HITS-CLIP	23824327
MIRT656306	hsa-miR-1277-3p	HITS-CLIP	23824327
MIRT656305	hsa-miR-885-5p	HITS-CLIP	23824327
MIRT656303	hsa-miR-1470	HITS-CLIP	23824327
MIRT656304	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT656302	hsa-miR-204-3p	HITS-CLIP	23824327
MIRT656301	hsa-miR-4646-5p	HITS-CLIP	23824327
MIRT656300	hsa-miR-4668-5p	HITS-CLIP	23824327
MIRT656299	hsa-miR-3153	HITS-CLIP	23824327
MIRT656298	hsa-miR-6733-5p	HITS-CLIP	23824327
MIRT656296	hsa-miR-6739-5p	HITS-CLIP	23824327
MIRT656297	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT656295	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT461485	hsa-miR-3910	PAR-CLIP	23592263
MIRT461484	hsa-miR-3154	PAR-CLIP	23592263
MIRT461483	hsa-miR-2392	PAR-CLIP	23592263
MIRT461482	hsa-miR-4459	PAR-CLIP	23592263
MIRT461481	hsa-miR-605-3p	PAR-CLIP	23592263
MIRT461480	hsa-miR-5004-5p	PAR-CLIP	23592263
MIRT461479	hsa-miR-3605-5p	PAR-CLIP	23592263
MIRT461478	hsa-miR-6894-5p	PAR-CLIP	23592263
MIRT461477	hsa-miR-1193	PAR-CLIP	23592263
MIRT461476	hsa-miR-4650-3p	PAR-CLIP	23592263
MIRT461475	hsa-miR-3529-5p	PAR-CLIP	23592263
MIRT461474	hsa-miR-379-5p	PAR-CLIP	23592263
MIRT461473	hsa-miR-4451	PAR-CLIP	23592263
MIRT461472	hsa-miR-4298	PAR-CLIP	23592263
MIRT1143754	hsa-miR-1285	CLIP-seq
MIRT1143755	hsa-miR-146b-3p	CLIP-seq
MIRT1143756	hsa-miR-1913	CLIP-seq
MIRT1143757	hsa-miR-1976	CLIP-seq
MIRT1143758	hsa-miR-3173-5p	CLIP-seq
MIRT1143759	hsa-miR-3187-5p	CLIP-seq
MIRT1143760	hsa-miR-324-3p	CLIP-seq
MIRT1143761	hsa-miR-3591-3p	CLIP-seq
MIRT1143762	hsa-miR-370	CLIP-seq
MIRT1143763	hsa-miR-4292	CLIP-seq
MIRT1143764	hsa-miR-4684-5p	CLIP-seq
MIRT1143765	hsa-miR-4727-5p	CLIP-seq
MIRT1143766	hsa-miR-4768-5p	CLIP-seq
MIRT1143767	hsa-miR-612	CLIP-seq
MIRT1143768	hsa-miR-874	CLIP-seq
MIRT2040904	hsa-miR-1915	CLIP-seq
MIRT2040905	hsa-miR-330-3p	CLIP-seq
MIRT2040906	hsa-miR-3667-5p	CLIP-seq
MIRT2040907	hsa-miR-4661-3p	CLIP-seq
MIRT2040908	hsa-miR-4726-3p	CLIP-seq
MIRT2040909	hsa-miR-4733-5p	CLIP-seq
MIRT2040910	hsa-miR-4747-5p	CLIP-seq
MIRT2040911	hsa-miR-7	CLIP-seq

Show/Hide all (32)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000049	Function	TRNA binding	IEA
GO:0003723	Function	RNA binding	IEA
GO:0005515	Function	Protein binding	IPI	15861136, 16189514, 25416956, 26751069, 31515488, 32296183, 33961781
GO:0005634	Component	Nucleus	IDA	15861136
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IDA
GO:0005829	Component	Cytosol	IDA
GO:0006400	Process	TRNA modification	IDA	12403464, 15861136
GO:0006400	Process	TRNA modification	IEA
GO:0008033	Process	TRNA processing	IEA
GO:0008168	Function	Methyltransferase activity	IEA
GO:0008176	Function	TRNA (guanine(46)-N7)-methyltransferase activity	IBA
GO:0008176	Function	TRNA (guanine(46)-N7)-methyltransferase activity	IDA	12403464, 15861136, 36599982, 36599985, 37369656
GO:0008176	Function	TRNA (guanine(46)-N7)-methyltransferase activity	IEA
GO:0008298	Process	Intracellular mRNA localization	IDA	37379838
GO:0016740	Function	Transferase activity	IEA
GO:0030488	Process	TRNA methylation	IBA
GO:0032259	Process	Methylation	IEA
GO:0033554	Process	Cellular response to stress	IDA	37379838
GO:0034063	Process	Stress granule assembly	IDA	32302570, 32302571
GO:0036265	Process	RNA (guanine-N7)-methylation	IBA
GO:0036265	Process	RNA (guanine-N7)-methylation	IDA	37379838
GO:0036416	Process	TRNA stabilization	IDA	36599982, 36599985
GO:0043527	Component	TRNA methyltransferase complex	IBA
GO:0051028	Process	MRNA transport	IDA	37379838
GO:0106004	Process	TRNA (guanine-N7)-methylation	IDA	36599982, 36599985, 37369656
GO:0106004	Process	TRNA (guanine-N7)-methylation	IEA
GO:0106143	Component	TRNA (m7G46) methyltransferase complex	IDA	36599982, 36599985
GO:0106143	Component	TRNA (m7G46) methyltransferase complex	IEA
GO:0160090	Function	Internal mRNA (guanine-N7-)-methyltransferase activity	IDA	31031084, 37379838
GO:0160090	Function	Internal mRNA (guanine-N7-)-methyltransferase activity	IEA

MIM	HGNC	e!Ensembl
604466	7030	ENSG00000037897

Q9UBP6

Protein name

tRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.33) (Methyltransferase-like protein 1) (mRNA (guanine-N(7)-)-methyltransferase) (EC 2.1.1.-) (miRNA (guanine-N(7)-)-methyltransferase) (EC 2.1.1.-) (tRNA (guanine(46)-N(7))-methyltransferase) (tRNA(m7G46)-m

Protein function

Catalytic component of METTL1-WDR4 methyltransferase complex that mediates the formation of N(7)-methylguanine in a subset of RNA species, such as tRNAs, mRNAs and microRNAs (miRNAs) (PubMed:12403464, PubMed:31031083, PubMed:31031084, PubMed:365

PDB

3CKK , 7OGJ , 7PL1 , 7U20 , 8CTH , 8CTI , 8D58 , 8D59 , 8D5B , 8D9K , 8D9L , 8EG0 , 8H0N

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02390	Methyltransf_4	76 → 254	Putative methyltransferase	Family

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:10329009}.

Sequence

MAAETRNVAGAEAPPPQKRYYRQRAHSNPMADHTLRYPVKPEEMDWSELYPEFFAPLTQN
QSHDDPKDKKEKRAQAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRI
RALRAAPAGGFQNIACLRSNAMKHLPNFFYKGQLTKMFFLFPDPHFKRTKHKWRIISPTL
LAEYAYVLRVGGLVYTITDVLELHDWMCTHFEEHPLFERVPLEDLSEDPVVGHLGTSTEE
GKKVLRNGGKNFPAIFRRIQDPVLQAVTSQTSLPGH

Sequence length

276

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Abnormality of neuronal migration	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALFORMATIONS OF CORTICAL DEVELOPMENT, GROUP II	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (22)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Ameloblastoma	Ameloblastoma	Pubtator	38309318	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	40683927	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	36599985, 36733406, 37516825	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36661684, 37528384	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract Congenital Nuclear Autosomal Recessive 2	Congenital cataract	Pubtator	36599982	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	31866582	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32135185	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	40658715	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	35574843	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	36733406	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31463732		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	34371184	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	35771136	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	GWASDB_DG	19525955		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	GWASCAT_DG	19525955		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	23160276	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	BEFREE	31321514		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	31463732		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	36545327	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	37516825, 37599359	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	33589575, 37863651	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	34936728	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

METTL1 (methyltransferase 1, tRNA methylguanosine)