MEP1A (meprin A subunit alpha)

Gene

• Entrez ID: 4224
• Gene name: Meprin A subunit alpha
• Gene symbol: MEP1A
• Synonyms (NCBI Gene): PPHA
• Chromosome: 6
• Chromosome location: 6p12.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT028824	hsa-miR-26b-5p	Microarray	19088304
MIRT737549	hsa-miR-155-5p	Luciferase reporter assay, Western blotting, Immunohistochemistry (IHC), Immunofluorescence	31877411
MIRT1143009	hsa-miR-203	CLIP-seq
MIRT2040692	hsa-miR-4477a	CLIP-seq
MIRT2040693	hsa-miR-513a-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CDX2	Activation	22326557

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004222	Function	Metalloendopeptidase activity	IBA
GO:0004222	Function	Metalloendopeptidase activity	IEA
GO:0005515	Function	Protein binding	IPI	9288916, 23123160
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	TAS	8262185
GO:0005886	Component	Plasma membrane	IDA	22923609
GO:0005886	Component	Plasma membrane	TAS	8262185
GO:0006508	Process	Proteolysis	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008237	Function	Metallopeptidase activity	IDA	22923609
GO:0008237	Function	Metallopeptidase activity	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0017090	Component	Meprin A complex	IDA	9288916
GO:0017090	Component	Meprin A complex	IEA
GO:0038004	Process	Epidermal growth factor receptor ligand maturation	IDA	22923609
GO:0046872	Function	Metal ion binding	IEA
GO:0070062	Component	Extracellular exosome	HDA	11487543
GO:0070573	Function	Metallodipeptidase activity	IDA	22923609
GO:0140448	Process	Signaling receptor ligand precursor processing	IBA
GO:0140448	Process	Signaling receptor ligand precursor processing	IDA	22923609

Other IDs

• MIM: 600388
• HGNC: 7015
• e!Ensembl: ENSG00000112818

Protein

• UniProt ID: Q16819
• Protein name: Meprin A subunit alpha (EC 3.4.24.18) (Endopeptidase-2) (N-benzoyl-L-tyrosyl-P-amino-benzoic acid hydrolase subunit alpha) (PABA peptide hydrolase) (PPH alpha)
• PDB: 7UAB, 7UAC, 7UAE, 7UAF, 7UAI
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01400	Astacin	73 → 261	Astacin (Peptidase family M12A)	Domain
  PF00629	MAM	269 → 432	MAM domain, meprin/A5/mu	Domain
  PF00008	EGF	674 → 708	EGF-like domain	Domain

• Sequence:

  MAWIRSTCILFFTLLFAHIAAVPIKYLPEENVHDADFGEQKDISEINLAAGLDLFQGDIL
  LQKSRNGLRDPNTRWTFPIPYILADNLGLNAKGAILYAFEMFRLKSCVDFKPYEGESSYI
  IFQQFDGCWSEVGDQHVGQNISIGQGCAYKAIIEHEILHALGFYHEQSRTDRDDYVNIWW
  DQILSGYQHNFDTYDDSLITDLNTPYDYESLMHYQPFSFNKNASVPTITAKIPEFNSIIG
  QRLDFSAIDLERLNRMYNCTTTHTLLDHCTFEKANICGMIQGTRDDTDWAHQDSAQAGEV
  DHTLLGQCTGAGYFMQFSTSSGSAEEAALLESRILYPKRKQQCLQFFYKMTGSPSDRLVV
  WVRRDDSTGNVRKLVKVQTFQGDDDHNWKIAHVVLKEEQKFRYLFQGTKGDPQNSTGGIY
  LDDITLTETPCPTGVWTVRNFSQVLENTSKGDKLQSPRFYNSEGYGFGVTLYPNSRESSG
  YLRLAFHVCSGENDAILEWPVENRQVIITILDQEPDVRNRMSSSMVFTTSKSHTSPAIND
  TVIWDRPSRVGTYHTDCNCFRSIDLGWSGFISHQMLKRRSFLKNDDLIIFVDFEDITHLS
  QTEVPTKGKRLSPQGLILQGQEQQVSEEGSGKAMLEEALPVSLSQGQPSRQKRSVENTGP
  LEDHNWPQYFRDPCDPNPCQNDGICVNVKGMASCRCISGHAFFYTGERCQAVQVHGSVLG
  MVIGGTAGVIFLTFSIIAILSQRPRK

• Sequence length: 746

Pathways

KEGG:

Protein digestion and absorption

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
COLONIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Autosomal Recessive Polycystic Kidney Disease	Polycystic kidney disease	BEFREE	7488157		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	27999200	Stimulate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	22326557		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	CTD_human_DG	15059925		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Carcinoma	Colorectal Cancer	BEFREE	27378469, 29325540		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	12189145		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	37276865	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	19262505, 22326557		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	37868053	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	25117438		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27999200		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	CTD_human_DG	15059925		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	27378469, 30334571		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	24388959		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	25117438		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	37868053	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	19262505, 22326557		★☆☆☆☆ Found in Text Mining only