MEOX2 (mesenchyme homeobox 2)

Gene

• Entrez ID: 4223
• Gene name: Mesenchyme homeobox 2
• Gene symbol: MEOX2
• Synonyms (NCBI Gene): GAX, MOX2
• Chromosome: 7
• Chromosome location: 7p21.2
• Summary: This gene encodes a member of a subfamily of non-clustered, diverged, antennapedia-like homeobox-containing genes. The encoded protein may play a role in the regulation of vertebrate limb myogenesis. Mutations in the related mouse protein may be associate

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT004358	hsa-miR-130a-3p	Luciferase reporter assay, qRT-PCR, Western blot, Northern blot	17957028
MIRT004358	hsa-miR-130a-3p	Review	19935707
MIRT003611	hsa-miR-301a-3p	Luciferase reporter assay	20470754
MIRT003611	hsa-miR-301a-3p	Luciferase reporter assay	20470754
MIRT003611	hsa-miR-301a-3p	Luciferase reporter assay, qRT-PCR, Western blot	22373864
MIRT003611	hsa-miR-301a-3p	Luciferase reporter assay, qRT-PCR, Western blot	22373864
MIRT003611	hsa-miR-301a-3p	Luciferase reporter assay, qRT-PCR, Western blot	22373864
MIRT003611	hsa-miR-301a-3p	Luciferase reporter assay, qRT-PCR, Western blot	22373864
MIRT003611	hsa-miR-301a-3p	Luciferase reporter assay, qRT-PCR, Western blot	22373864
MIRT003611	hsa-miR-301a-3p	Luciferase reporter assay, qRT-PCR, Western blot	22373864
MIRT018453	hsa-miR-335-5p	Microarray	18185580
MIRT004358	hsa-miR-130a-3p	Reporter assay;Other	17957028
MIRT024208	hsa-miR-221-3p	Western blot;qRT-PCR	20516212
MIRT044481	hsa-miR-320a	CLASH	23622248
MIRT714961	hsa-miR-1183	HITS-CLIP	19536157
MIRT714960	hsa-miR-138-1-3p	HITS-CLIP	19536157
MIRT714959	hsa-miR-4742-3p	HITS-CLIP	19536157
MIRT714958	hsa-miR-4684-5p	HITS-CLIP	19536157
MIRT714957	hsa-miR-4768-5p	HITS-CLIP	19536157
MIRT714956	hsa-miR-6833-3p	HITS-CLIP	19536157
MIRT714955	hsa-miR-6809-3p	HITS-CLIP	19536157
MIRT714961	hsa-miR-1183	HITS-CLIP	19536157
MIRT714960	hsa-miR-138-1-3p	HITS-CLIP	19536157
MIRT714959	hsa-miR-4742-3p	HITS-CLIP	19536157
MIRT714958	hsa-miR-4684-5p	HITS-CLIP	19536157
MIRT714957	hsa-miR-4768-5p	HITS-CLIP	19536157
MIRT714956	hsa-miR-6833-3p	HITS-CLIP	19536157
MIRT714955	hsa-miR-6809-3p	HITS-CLIP	19536157
MIRT714961	hsa-miR-1183	HITS-CLIP	19536157
MIRT714960	hsa-miR-138-1-3p	HITS-CLIP	19536157
MIRT714959	hsa-miR-4742-3p	HITS-CLIP	19536157
MIRT714958	hsa-miR-4684-5p	HITS-CLIP	19536157
MIRT714957	hsa-miR-4768-5p	HITS-CLIP	19536157
MIRT714956	hsa-miR-6833-3p	HITS-CLIP	19536157
MIRT714955	hsa-miR-6809-3p	HITS-CLIP	19536157
MIRT733710	hsa-miR-141-5p	Luciferase reporter assay, Western blotting, Immunoprecipitaion (IP), RNA-seq, qRT-PCR	33627047
MIRT714961	hsa-miR-1183	HITS-CLIP	19536157
MIRT714960	hsa-miR-138-1-3p	HITS-CLIP	19536157
MIRT714959	hsa-miR-4742-3p	HITS-CLIP	19536157
MIRT714958	hsa-miR-4684-5p	HITS-CLIP	19536157
MIRT714957	hsa-miR-4768-5p	HITS-CLIP	19536157
MIRT714956	hsa-miR-6833-3p	HITS-CLIP	19536157
MIRT714955	hsa-miR-6809-3p	HITS-CLIP	19536157
MIRT714961	hsa-miR-1183	HITS-CLIP	19536157
MIRT714960	hsa-miR-138-1-3p	HITS-CLIP	19536157
MIRT714959	hsa-miR-4742-3p	HITS-CLIP	19536157
MIRT714958	hsa-miR-4684-5p	HITS-CLIP	19536157
MIRT714957	hsa-miR-4768-5p	HITS-CLIP	19536157
MIRT714956	hsa-miR-6833-3p	HITS-CLIP	19536157
MIRT714955	hsa-miR-6809-3p	HITS-CLIP	19536157
MIRT714961	hsa-miR-1183	HITS-CLIP	19536157
MIRT714960	hsa-miR-138-1-3p	HITS-CLIP	19536157
MIRT714959	hsa-miR-4742-3p	HITS-CLIP	19536157
MIRT714958	hsa-miR-4684-5p	HITS-CLIP	19536157
MIRT714957	hsa-miR-4768-5p	HITS-CLIP	19536157
MIRT714956	hsa-miR-6833-3p	HITS-CLIP	19536157
MIRT714955	hsa-miR-6809-3p	HITS-CLIP	19536157
MIRT1142997	hsa-miR-219-5p	CLIP-seq
MIRT1142998	hsa-miR-4445	CLIP-seq
MIRT1142999	hsa-miR-4782-3p	CLIP-seq
MIRT1143000	hsa-miR-508-3p	CLIP-seq
MIRT1143001	hsa-miR-548ac	CLIP-seq
MIRT1143002	hsa-miR-548ae	CLIP-seq
MIRT1143003	hsa-miR-548aj	CLIP-seq
MIRT1143004	hsa-miR-548am	CLIP-seq
MIRT1143005	hsa-miR-548d-3p	CLIP-seq
MIRT1143006	hsa-miR-548x	CLIP-seq
MIRT1143007	hsa-miR-548z	CLIP-seq
MIRT1143008	hsa-miR-593	CLIP-seq
MIRT2040688	hsa-miR-1208	CLIP-seq
MIRT2040689	hsa-miR-412	CLIP-seq
MIRT2040690	hsa-miR-4318	CLIP-seq
MIRT2040691	hsa-miR-4420	CLIP-seq
MIRT2040688	hsa-miR-1208	CLIP-seq
MIRT2040689	hsa-miR-412	CLIP-seq
MIRT2040690	hsa-miR-4318	CLIP-seq
MIRT2040691	hsa-miR-4420	CLIP-seq
MIRT2270419	hsa-miR-4775	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ZEB2	Repression	20516212

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	17074759
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	17074759
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IMP	17074759
GO:0001525	Process	Angiogenesis	IEA
GO:0001757	Process	Somite specification	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	22206000
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	16335786, 25416956, 25910212, 30886144, 31515488
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	22206000
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IDA	16335786
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0007519	Process	Skeletal muscle tissue development	IEA
GO:0016607	Component	Nuclear speck	IEA
GO:0043565	Function	Sequence-specific DNA binding	IDA	9073066
GO:0043565	Function	Sequence-specific DNA binding	IMP	22206000
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	17074759
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	17074759
GO:0060021	Process	Roof of mouth development	IEA
GO:0060173	Process	Limb development	IEA
GO:0061053	Process	Somite development	IBA
GO:0090051	Process	Negative regulation of cell migration involved in sprouting angiogenesis	IGI	20516212
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

Other IDs

• MIM: 600535
• HGNC: 7014
• e!Ensembl: ENSG00000106511

Protein

• UniProt ID: P50222
• Protein name: Homeobox protein MOX-2 (Growth arrest-specific homeobox) (Mesenchyme homeobox 2)
• Protein function: Mesodermal transcription factor that plays a key role in somitogenesis and somitogenesis and limb muscle differentiation (By similarity). Required during limb development for normal appendicular muscle formation and for the normal regulation of
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00046	Homeodomain	188 → 244	Homeodomain	Domain

• Sequence:

  MEHPLFGCLRSPHATAQGLHPFSQSSLALHGRSDHMSYPELSTSSSSCIIAGYPNEEGMF
  ASQHHRGHHHHHHHHHHHHHQQQQHQALQTNWHLPQMSSPPSAARHSLCLQPDSGGPPEL
  GSSPPVLCSNSSSLGSSTPTGAACAPGDYGRQALSPAEAEKRSGGKRKSDSSDSQEGNYK
  SEVNSKPRKERTAFTKEQIRELEAEFAHHNYLTRLRRYEIAVNLDLTERQVKVWFQNRRM
  KWKRVKGGQQGAAAREKELVNVKKGTLLPSELSGIGAATLQQTGDSIANEDSHDSDHSSE
  HAHL

• Sequence length: 304

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BEHCET'S SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	32013628	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	32631335	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	29940775		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	25460568, 28978016, 30659268		★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	38084139	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	26428460	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34294834	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	26428460	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	26428460		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	27966787		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	27966787	Stimulate	★☆☆☆☆ Found in Text Mining only
Digestive System Neoplasms	Digestive system neoplasm	Pubtator	34160343	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	34160343	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	34160343	Associate	★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	BEFREE	30616143		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	30659268		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	30659268, 36980184	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	30659268		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	30659268	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	28514291	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	38341328	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	22373864, 30659268		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	25460568, 30659268, 33627047	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	25460568, 28978016, 30659268		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29940775		★☆☆☆☆ Found in Text Mining only
Meningomyelocele	Meningomyelocele	BEFREE	18336610		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	26428460	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16214533		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	19760604, 21080955		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	25460568		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	40119426	Associate	★☆☆☆☆ Found in Text Mining only
Portal Hypertension	Portal Hypertension	BEFREE	16698584		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	39344312	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	28514291	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	28514291		★☆☆☆☆ Found in Text Mining only
Uranostaphyloschisis	Uranostaphyloschisis	BEFREE	29030958		★☆☆☆☆ Found in Text Mining only