Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	4216
Gene name	Mitogen-activated protein kinase kinase kinase 4
Gene symbol	MAP3K4
Synonyms (NCBI Gene)	MAPKKK4MEKK 4MEKK4MTK1PRO0412
Chromosome	6
Chromosome location	6q26
Summary	The central core of each mitogen-activated protein kinase (MAPK) pathway is a conserved cascade of 3 protein kinases: an activated MAPK kinase kinase (MAPKKK) phosphorylates and activates a specific MAPK kinase (MAPKK), which then activates a specific MAP

105

Show/Hide all (105)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022893	hsa-miR-124-3p	Microarray	18668037
MIRT049769	hsa-miR-92a-3p	CLASH	23622248
MIRT048846	hsa-miR-93-5p	CLASH	23622248
MIRT048040	hsa-miR-148a-3p	CLASH	23622248
MIRT099168	hsa-miR-199a-3p	PAR-CLIP	23592263
MIRT099169	hsa-miR-199b-3p	PAR-CLIP	23592263
MIRT099174	hsa-miR-3129-5p	PAR-CLIP	23592263
MIRT493269	hsa-miR-101-3p	PAR-CLIP	23592263
MIRT493269	hsa-miR-101-3p	PAR-CLIP	23592263
MIRT493268	hsa-miR-144-3p	PAR-CLIP	23592263
MIRT099173	hsa-miR-3123	PAR-CLIP	23592263
MIRT099172	hsa-miR-1245a	PAR-CLIP	23592263
MIRT099181	hsa-miR-8079	PAR-CLIP	23592263
MIRT099180	hsa-miR-8062	PAR-CLIP	23592263
MIRT099176	hsa-miR-3691-3p	PAR-CLIP	23592263
MIRT099178	hsa-miR-6073	PAR-CLIP	23592263
MIRT048040	hsa-miR-148a-3p	Luciferase reporter assayqRT-PCRWestern blot	26253263
MIRT099168	hsa-miR-199a-3p	PAR-CLIP	23592263
MIRT099169	hsa-miR-199b-3p	PAR-CLIP	23592263
MIRT099174	hsa-miR-3129-5p	PAR-CLIP	23592263
MIRT493269	hsa-miR-101-3p	PAR-CLIP	23592263
MIRT493269	hsa-miR-101-3p	PAR-CLIP	23592263
MIRT493268	hsa-miR-144-3p	PAR-CLIP	23592263
MIRT099173	hsa-miR-3123	PAR-CLIP	23592263
MIRT099172	hsa-miR-1245a	PAR-CLIP	23592263
MIRT099181	hsa-miR-8079	PAR-CLIP	23592263
MIRT099180	hsa-miR-8062	PAR-CLIP	23592263
MIRT099176	hsa-miR-3691-3p	PAR-CLIP	23592263
MIRT099178	hsa-miR-6073	PAR-CLIP	23592263
MIRT1128996	hsa-miR-128	CLIP-seq
MIRT1128997	hsa-miR-148a	CLIP-seq
MIRT1128998	hsa-miR-148b	CLIP-seq
MIRT1128999	hsa-miR-152	CLIP-seq
MIRT1129000	hsa-miR-27a	CLIP-seq
MIRT1129001	hsa-miR-27b	CLIP-seq
MIRT1129002	hsa-miR-3065-5p	CLIP-seq
MIRT1129003	hsa-miR-4697-3p	CLIP-seq
MIRT1129004	hsa-miR-4768-3p	CLIP-seq
MIRT1129005	hsa-miR-495	CLIP-seq
MIRT1129006	hsa-miR-513a-5p	CLIP-seq
MIRT1129007	hsa-miR-548ac	CLIP-seq
MIRT1129008	hsa-miR-548ae	CLIP-seq
MIRT1129009	hsa-miR-548aj	CLIP-seq
MIRT1129010	hsa-miR-548am	CLIP-seq
MIRT1129011	hsa-miR-548d-3p	CLIP-seq
MIRT1129012	hsa-miR-548m	CLIP-seq
MIRT1129013	hsa-miR-548x	CLIP-seq
MIRT1129014	hsa-miR-548z	CLIP-seq
MIRT1129015	hsa-miR-624	CLIP-seq
MIRT1129004	hsa-miR-4768-3p	CLIP-seq
MIRT1128996	hsa-miR-128	CLIP-seq
MIRT2266906	hsa-miR-1324	CLIP-seq
MIRT1128997	hsa-miR-148a	CLIP-seq
MIRT1128998	hsa-miR-148b	CLIP-seq
MIRT1128999	hsa-miR-152	CLIP-seq
MIRT2266907	hsa-miR-15a	CLIP-seq
MIRT2266908	hsa-miR-15b	CLIP-seq
MIRT2266909	hsa-miR-16	CLIP-seq
MIRT2266910	hsa-miR-195	CLIP-seq
MIRT2266911	hsa-miR-214	CLIP-seq
MIRT1129000	hsa-miR-27a	CLIP-seq
MIRT1129001	hsa-miR-27b	CLIP-seq
MIRT1129002	hsa-miR-3065-5p	CLIP-seq
MIRT2266912	hsa-miR-3202	CLIP-seq
MIRT2266913	hsa-miR-3619-5p	CLIP-seq
MIRT2266914	hsa-miR-424	CLIP-seq
MIRT2266915	hsa-miR-432	CLIP-seq
MIRT2266916	hsa-miR-4533	CLIP-seq
MIRT1129003	hsa-miR-4697-3p	CLIP-seq
MIRT2266917	hsa-miR-4722-5p	CLIP-seq
MIRT1129004	hsa-miR-4768-3p	CLIP-seq
MIRT1129005	hsa-miR-495	CLIP-seq
MIRT2266918	hsa-miR-497	CLIP-seq
MIRT1129006	hsa-miR-513a-5p	CLIP-seq
MIRT1129007	hsa-miR-548ac	CLIP-seq
MIRT1129008	hsa-miR-548ae	CLIP-seq
MIRT1129009	hsa-miR-548aj	CLIP-seq
MIRT1129010	hsa-miR-548am	CLIP-seq
MIRT1129011	hsa-miR-548d-3p	CLIP-seq
MIRT1129012	hsa-miR-548m	CLIP-seq
MIRT1129013	hsa-miR-548x	CLIP-seq
MIRT1129014	hsa-miR-548z	CLIP-seq
MIRT2266919	hsa-miR-622	CLIP-seq
MIRT2266920	hsa-miR-761	CLIP-seq
MIRT2566450	hsa-miR-1914	CLIP-seq
MIRT2566451	hsa-miR-3065-3p	CLIP-seq
MIRT2266912	hsa-miR-3202	CLIP-seq
MIRT2566452	hsa-miR-3622a-3p	CLIP-seq
MIRT2566453	hsa-miR-3622b-3p	CLIP-seq
MIRT2566454	hsa-miR-380	CLIP-seq
MIRT2566455	hsa-miR-3924	CLIP-seq
MIRT2566456	hsa-miR-3944-5p	CLIP-seq
MIRT2266915	hsa-miR-432	CLIP-seq
MIRT2566457	hsa-miR-4495	CLIP-seq
MIRT2266916	hsa-miR-4533	CLIP-seq
MIRT2266919	hsa-miR-622	CLIP-seq
MIRT2566450	hsa-miR-1914	CLIP-seq
MIRT2566451	hsa-miR-3065-3p	CLIP-seq
MIRT2266912	hsa-miR-3202	CLIP-seq
MIRT2566452	hsa-miR-3622a-3p	CLIP-seq
MIRT2566453	hsa-miR-3622b-3p	CLIP-seq
MIRT2566456	hsa-miR-3944-5p	CLIP-seq
MIRT2266915	hsa-miR-432	CLIP-seq
MIRT2266916	hsa-miR-4533	CLIP-seq
MIRT2266919	hsa-miR-622	CLIP-seq

Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	IDA	9305639, 9827804
GO:0000165	Process	MAPK cascade	IEA
GO:0000166	Function	Nucleotide binding	IEA
GO:0001890	Process	Placenta development	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004709	Function	MAP kinase kinase kinase activity	IDA	9305639, 9827804
GO:0004709	Function	MAP kinase kinase kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	12052864, 16157600, 16256071, 19270716, 20221403, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IDA	9827804
GO:0005737	Component	Cytoplasm	IEA
GO:0010225	Process	Response to UV-C	IMP	9305639
GO:0010468	Process	Regulation of gene expression	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0019100	Process	Male germ-line sex determination	IEA
GO:0032206	Process	Positive regulation of telomere maintenance	IMP	21531765
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0035556	Process	Intracellular signal transduction	ISS
GO:0038066	Process	P38MAPK cascade	IBA
GO:0043507	Process	Positive regulation of JUN kinase activity	IDA	9305639
GO:0046872	Function	Metal ion binding	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0060718	Process	Chorionic trophoblast cell differentiation	IEA
GO:0106310	Function	Protein serine kinase activity	IEA
GO:1900745	Process	Positive regulation of p38MAPK cascade	IDA	9305639

MIM	HGNC	e!Ensembl
602425	6856	ENSG00000085511

Q9Y6R4

Protein name

Mitogen-activated protein kinase kinase kinase 4 (EC 2.7.11.25) (MAP three kinase 1) (MAPK/ERK kinase kinase 4) (MEK kinase 4) (MEKK 4)

Protein function

Component of a protein kinase signal transduction cascade. Activates the CSBP2, P38 and JNK MAPK pathways, but not the ERK pathway. Specifically phosphorylates and activates MAP2K4 and MAP2K6. {ECO:0000269|PubMed:12052864, ECO:0000269|PubMed:930

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	1343 → 1601	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed at high levels in heart, placenta, skeletal muscle and pancreas, and at lower levels in other tissues. {ECO:0000269|PubMed:9305639}.

Sequence

MREAAAALVPPPAFAVTPAAAMEEPPPPPPPPPPPPEPETESEPECCLAARQEGTLGDSA
CKSPESDLEDFSDETNTENLYGTSPPSTPRQMKRMSTKHQRNNVGRPASRSNLKEKMNAP
NQPPHKDTGKTVENVEEYSYKQEKKIRAALRTTERDRKKNVQCSFMLDSVGGSLPKKSIP
DVDLNKPYLSLGCSNAKLPVSVPMPIARPARQTSRTDCPADRLKFFETLRLLLKLTSVSK
KKDREQRGQENTSGFWLNRSNELIWLELQAWHAGRTINDQDFFLYTARQAIPDIINEILT
FKVDYGSFAFVRDRAGFNGTSVEGQCKATPGTKIVGYSTHHEHLQRQRVSFEQVKRIMEL
LEYIEALYPSLQALQKDYEKYAAKDFQDRVQALCLWLNITKDLNQKLRIMGTVLGIKNLS
DIGWPVFEIPSPRPSKGNEPEYEGDDTEGELKELESSTDESEEEQISDPRVPEIRQPIDN
SFDIQSRDCISKKLERLESEDDSLGWGAPDWSTEAGFSRHCLTSIYRPFVDKALKQMGLR
KLILRLHKLMDGSLQRARIALVKNDRPVEFSEFPDPMWGSDYVQLSRTPPSSEEKCSAVS
WEELKAMDLPSFEPAFLVLCRVLLNVIHECLKLRLEQRPAGEPSLLSIKQLVRECKEVLK
GGLLMKQYYQFMLQEVLEDLEKPDCNIDAFEEDLHKMLMVYFDYMRSWIQMLQQLPQASH
SLKNLLEEEWNFTKEITHYIRGGEAQAGKLFCDIAGMLLKSTGSFLEFGLQESCAEFWTS
ADDSSASDEIRRSVIEISRALKELFHEARERASKALGFAKMLRKDLEIAAEFRLSAPVRD
LLDVLKSKQYVKVQIPGLENLQMFVPDTLAEEKSIILQLLNAAAGKDCSKDSDDVLIDAY
LLLTKHGDRARDSEDSWGTWEAQPVKVVPQVETVDTLRSMQVDNLLLVVMQSAHLTIQRK
AFQQSIEGLMTLCQEQTSSQPVIAKALQQLKNDALELCNRISNAIDRVDHMFTSEFDAEV
DESESVTLQQYYREAMIQGYNFGFEYHKEVVRLMSGEFRQKIGDKYISFARKWMNYVLTK
CESGRGTRPRWATQGFDFLQAIEPAFISALPEDDFLSLQALMNECIGHVIGKPHSPVTGL
YLAIHRNSPRPMKVPRCHSDPPNPHLIIPTPEGFSTRSMPSDARSHGSPAAAAAAAAAAV
AASRPSPSGGDSVLPKSISSAHDTRGSSVPENDRLASIAAELQFRSLSRHSSPTEERDEP
AYPRGDSSGSTRRSWELRTLISQSKDTASKLGPIEAIQKSVRLFEEKRYREMRRKNIIGQ
VCDTPKSYDNVMHVGLRKVTFKWQRGNKIGEGQYGKVYTCISVDTGELMAMKEIRFQPND
HKTIKETADELKIFEGIKHPNLVRYFGVELHREEMYIFMEYCDEGTLEEVSRLGLQEHVI
RLYSKQITIAINVLHEHGIVHRDIKGANIFLTSSGLIKLGDFGCSVKLKNNAQTMPGEVN
STLGTAAYMAPEVITRAKGEGHGRAADIWSLGCVVIEMVTGKRPWHEYEHNFQIMYKVGM
GHKPPIPERLSPEGKDFLSHCLESDPKMRWTASQLLDHSFVKVCTDEE

Sequence length

1608

Interactions

View interactions

	KEGG
	MAPK signaling pathway GnRH signaling pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
WILMS TUMOR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (31)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Bilateral Wilms Tumor	Wilms tumor	CTD_human_DG	28825729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	31346208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	27869167	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	33149122	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	14734742		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	31694657	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	CTD_human_DG	23104009		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	CTD_human_DG	23104009		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	23104009	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	BEFREE	28333195		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	GWASCAT_DG	28333195		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	Pubtator	28333195	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glycogen Storage Disease Type II	Glycogen storage disease	Pubtator	23940728	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	31694657	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	33853833	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	31346208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	31075266		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	22589389	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	CTD_human_DG	28825729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	24448499	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Serous Adenocarcinoma	Ovarian serous adenocarcinoma	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	31075266		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periventricular Nodular Heterotopia	Periventricular Nodular Heterotopia	BEFREE	18201775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	36750863	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	26459919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	26459919	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	GWASDB_DG	22491018		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	26253263		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	25173755	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	27440446	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	28825729	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

MAP3K4 (mitogen-activated protein kinase kinase kinase 4)