MEIS1 (Meis homeobox 1)

Gene

• Entrez ID: 4211
• Gene name: Meis homeobox 1
• Gene symbol: MEIS1
• Synonyms (NCBI Gene): -
• Chromosome: 2
• Chromosome location: 2p14
• Summary: Homeobox genes, of which the most well-characterized category is represented by the HOX genes, play a crucial role in normal development. In addition, several homeoproteins are involved in neoplasia. This gene encodes a homeobox protein belonging to the T

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT000189	hsa-miR-204-5p	Review	20029422
MIRT000287	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR, Western blot	18950466
MIRT004962	hsa-let-7a-5p	qRT-PCR	17942906
MIRT004946	hsa-miR-98-5p	qRT-PCR	17942906
MIRT000189	hsa-miR-204-5p	Luciferase reporter assay, Microarray, Western blot	18308931
MIRT007195	hsa-miR-495-3p	Immunoblot, Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23132946
MIRT007195	hsa-miR-495-3p	Immunoblot, Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23132946
MIRT000287	hsa-miR-155-5p	Proteomics	18668040
MIRT000189	hsa-miR-204-5p	Reporter assay;Western blot;Other	18308931
MIRT027307	hsa-miR-101-3p	Western blot	18308931
MIRT030714	hsa-miR-21-5p	Microarray	18591254
MIRT041845	hsa-miR-484	CLASH	23622248
MIRT053331	hsa-miR-196b-5p	Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	22353710
MIRT053331	hsa-miR-196b-5p	Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	22353710
MIRT498822	hsa-miR-4311	PAR-CLIP	20371350
MIRT498822	hsa-miR-4311	PAR-CLIP	22012620
MIRT498822	hsa-miR-4311	PAR-CLIP	24398324
MIRT734693	hsa-miR-1261	qRT-PCR	31484947
MIRT498822	hsa-miR-4311	PAR-CLIP	20371350
MIRT498822	hsa-miR-4311	PAR-CLIP	22012620
MIRT498822	hsa-miR-4311	PAR-CLIP	24398324
MIRT1142723	hsa-miR-1179	CLIP-seq
MIRT1142724	hsa-miR-1256	CLIP-seq
MIRT1142725	hsa-miR-1273g	CLIP-seq
MIRT1142726	hsa-miR-129-5p	CLIP-seq
MIRT1142727	hsa-miR-1299	CLIP-seq
MIRT1142728	hsa-miR-1303	CLIP-seq
MIRT1142729	hsa-miR-145	CLIP-seq
MIRT1142730	hsa-miR-18a	CLIP-seq
MIRT1142731	hsa-miR-18b	CLIP-seq
MIRT1142732	hsa-miR-1910	CLIP-seq
MIRT1142733	hsa-miR-19a	CLIP-seq
MIRT1142734	hsa-miR-19b	CLIP-seq
MIRT1142735	hsa-miR-203	CLIP-seq
MIRT1142736	hsa-miR-204	CLIP-seq
MIRT1142737	hsa-miR-211	CLIP-seq
MIRT1142738	hsa-miR-217	CLIP-seq
MIRT1142739	hsa-miR-219-5p	CLIP-seq
MIRT1142740	hsa-miR-2392	CLIP-seq
MIRT1142741	hsa-miR-23a	CLIP-seq
MIRT1142742	hsa-miR-23b	CLIP-seq
MIRT1142743	hsa-miR-23c	CLIP-seq
MIRT1142744	hsa-miR-3148	CLIP-seq
MIRT1142745	hsa-miR-3151	CLIP-seq
MIRT1142746	hsa-miR-3166	CLIP-seq
MIRT1142747	hsa-miR-3180	CLIP-seq
MIRT1142748	hsa-miR-3180-3p	CLIP-seq
MIRT1142749	hsa-miR-3180-5p	CLIP-seq
MIRT1142750	hsa-miR-3189-3p	CLIP-seq
MIRT1142751	hsa-miR-3190	CLIP-seq
MIRT1142752	hsa-miR-3196	CLIP-seq
MIRT1142753	hsa-miR-323-5p	CLIP-seq
MIRT1142754	hsa-miR-323b-5p	CLIP-seq
MIRT1142755	hsa-miR-338-5p	CLIP-seq
MIRT1142756	hsa-miR-3618	CLIP-seq
MIRT1142757	hsa-miR-3678-3p	CLIP-seq
MIRT1142758	hsa-miR-371-5p	CLIP-seq
MIRT1142759	hsa-miR-3911	CLIP-seq
MIRT1142760	hsa-miR-3938	CLIP-seq
MIRT1142761	hsa-miR-4282	CLIP-seq
MIRT1142762	hsa-miR-4302	CLIP-seq
MIRT1142763	hsa-miR-4307	CLIP-seq
MIRT1142764	hsa-miR-4418	CLIP-seq
MIRT1142765	hsa-miR-4432	CLIP-seq
MIRT1142766	hsa-miR-4445	CLIP-seq
MIRT1142767	hsa-miR-4448	CLIP-seq
MIRT1142768	hsa-miR-4468	CLIP-seq
MIRT1142769	hsa-miR-4477a	CLIP-seq
MIRT1142770	hsa-miR-448	CLIP-seq
MIRT1142771	hsa-miR-450b-5p	CLIP-seq
MIRT1142772	hsa-miR-4639-3p	CLIP-seq
MIRT1142773	hsa-miR-4641	CLIP-seq
MIRT1142774	hsa-miR-4642	CLIP-seq
MIRT1142775	hsa-miR-4663	CLIP-seq
MIRT1142776	hsa-miR-4684-3p	CLIP-seq
MIRT1142777	hsa-miR-4685-5p	CLIP-seq
MIRT1142778	hsa-miR-4699-3p	CLIP-seq
MIRT1142779	hsa-miR-4704-3p	CLIP-seq
MIRT1142780	hsa-miR-4709-3p	CLIP-seq
MIRT1142781	hsa-miR-4720-3p	CLIP-seq
MIRT1142782	hsa-miR-4735-3p	CLIP-seq
MIRT1142783	hsa-miR-4755-5p	CLIP-seq
MIRT1142784	hsa-miR-4771	CLIP-seq
MIRT1142785	hsa-miR-4782-3p	CLIP-seq
MIRT1142786	hsa-miR-4782-5p	CLIP-seq
MIRT1142787	hsa-miR-4793-3p	CLIP-seq
MIRT1142788	hsa-miR-4804-3p	CLIP-seq
MIRT1142789	hsa-miR-499-5p	CLIP-seq
MIRT1142790	hsa-miR-507	CLIP-seq
MIRT1142791	hsa-miR-508-3p	CLIP-seq
MIRT1142792	hsa-miR-509-3-5p	CLIP-seq
MIRT1142793	hsa-miR-509-5p	CLIP-seq
MIRT1142794	hsa-miR-513a-3p	CLIP-seq
MIRT1142795	hsa-miR-516b	CLIP-seq
MIRT1142796	hsa-miR-557	CLIP-seq
MIRT1142797	hsa-miR-558	CLIP-seq
MIRT1142798	hsa-miR-568	CLIP-seq
MIRT1142799	hsa-miR-586	CLIP-seq
MIRT1142800	hsa-miR-622	CLIP-seq
MIRT1142801	hsa-miR-648	CLIP-seq
MIRT1142802	hsa-miR-765	CLIP-seq
MIRT1142803	hsa-miR-876-3p	CLIP-seq
MIRT1142804	hsa-miR-888	CLIP-seq
MIRT1142805	hsa-miR-934	CLIP-seq
MIRT2040655	hsa-miR-1178	CLIP-seq
MIRT1142723	hsa-miR-1179	CLIP-seq
MIRT2040656	hsa-miR-142-5p	CLIP-seq
MIRT1142755	hsa-miR-338-5p	CLIP-seq
MIRT2040657	hsa-miR-369-3p	CLIP-seq
MIRT2040658	hsa-miR-374a	CLIP-seq
MIRT2040659	hsa-miR-374b	CLIP-seq
MIRT2040660	hsa-miR-505	CLIP-seq
MIRT1142802	hsa-miR-765	CLIP-seq
MIRT2390807	hsa-miR-1	CLIP-seq
MIRT2390808	hsa-miR-198	CLIP-seq
MIRT2390809	hsa-miR-206	CLIP-seq
MIRT2390810	hsa-miR-4710	CLIP-seq
MIRT2390811	hsa-miR-4792	CLIP-seq
MIRT2390812	hsa-miR-613	CLIP-seq
MIRT2390813	hsa-miR-665	CLIP-seq
MIRT2431099	hsa-miR-300	CLIP-seq
MIRT2431100	hsa-miR-378g	CLIP-seq
MIRT2431101	hsa-miR-381	CLIP-seq
MIRT2431102	hsa-miR-4666-3p	CLIP-seq
MIRT2431103	hsa-miR-4789-5p	CLIP-seq
MIRT2431104	hsa-miR-4795-3p	CLIP-seq
MIRT2390807	hsa-miR-1	CLIP-seq
MIRT2569496	hsa-miR-1208	CLIP-seq
MIRT2569497	hsa-miR-1225-5p	CLIP-seq
MIRT2569498	hsa-miR-1228	CLIP-seq
MIRT1142724	hsa-miR-1256	CLIP-seq
MIRT2569499	hsa-miR-1262	CLIP-seq
MIRT2569500	hsa-miR-1293	CLIP-seq
MIRT1142726	hsa-miR-129-5p	CLIP-seq
MIRT2569501	hsa-miR-1301	CLIP-seq
MIRT1142729	hsa-miR-145	CLIP-seq
MIRT1142732	hsa-miR-1910	CLIP-seq
MIRT2569502	hsa-miR-193a-5p	CLIP-seq
MIRT2569503	hsa-miR-1976	CLIP-seq
MIRT2390808	hsa-miR-198	CLIP-seq
MIRT1142733	hsa-miR-19a	CLIP-seq
MIRT1142734	hsa-miR-19b	CLIP-seq
MIRT2390809	hsa-miR-206	CLIP-seq
MIRT1142739	hsa-miR-219-5p	CLIP-seq
MIRT2569504	hsa-miR-221	CLIP-seq
MIRT2569505	hsa-miR-222	CLIP-seq
MIRT1142740	hsa-miR-2392	CLIP-seq
MIRT2569506	hsa-miR-28-3p	CLIP-seq
MIRT2431099	hsa-miR-300	CLIP-seq
MIRT2569507	hsa-miR-3065-5p	CLIP-seq
MIRT2569508	hsa-miR-3147	CLIP-seq
MIRT1142745	hsa-miR-3151	CLIP-seq
MIRT2569509	hsa-miR-3170	CLIP-seq
MIRT1142747	hsa-miR-3180	CLIP-seq
MIRT1142748	hsa-miR-3180-3p	CLIP-seq
MIRT1142749	hsa-miR-3180-5p	CLIP-seq
MIRT1142750	hsa-miR-3189-3p	CLIP-seq
MIRT1142752	hsa-miR-3196	CLIP-seq
MIRT2569510	hsa-miR-3199	CLIP-seq
MIRT2569511	hsa-miR-331-3p	CLIP-seq
MIRT2569512	hsa-miR-3613-3p	CLIP-seq
MIRT2569513	hsa-miR-3614-3p	CLIP-seq
MIRT1142756	hsa-miR-3618	CLIP-seq
MIRT2569514	hsa-miR-3619-3p	CLIP-seq
MIRT2569515	hsa-miR-3653	CLIP-seq
MIRT2569516	hsa-miR-3658	CLIP-seq
MIRT2569517	hsa-miR-3679-3p	CLIP-seq
MIRT2040657	hsa-miR-369-3p	CLIP-seq
MIRT2569518	hsa-miR-374c	CLIP-seq
MIRT2431100	hsa-miR-378g	CLIP-seq
MIRT2431101	hsa-miR-381	CLIP-seq
MIRT1142761	hsa-miR-4282	CLIP-seq
MIRT2569519	hsa-miR-4283	CLIP-seq
MIRT2569520	hsa-miR-4289	CLIP-seq
MIRT2569521	hsa-miR-4297	CLIP-seq
MIRT1142762	hsa-miR-4302	CLIP-seq
MIRT2569522	hsa-miR-4318	CLIP-seq
MIRT2569523	hsa-miR-4425	CLIP-seq
MIRT1142765	hsa-miR-4432	CLIP-seq
MIRT1142766	hsa-miR-4445	CLIP-seq
MIRT2569524	hsa-miR-4447	CLIP-seq
MIRT1142767	hsa-miR-4448	CLIP-seq
MIRT1142768	hsa-miR-4468	CLIP-seq
MIRT2569525	hsa-miR-4472	CLIP-seq
MIRT1142769	hsa-miR-4477a	CLIP-seq
MIRT2569526	hsa-miR-4483	CLIP-seq
MIRT2569527	hsa-miR-4489	CLIP-seq
MIRT2569528	hsa-miR-450a	CLIP-seq
MIRT1142771	hsa-miR-450b-5p	CLIP-seq
MIRT2569529	hsa-miR-4511	CLIP-seq
MIRT2569530	hsa-miR-452	CLIP-seq
MIRT2569531	hsa-miR-4535	CLIP-seq
MIRT1142773	hsa-miR-4641	CLIP-seq
MIRT1142774	hsa-miR-4642	CLIP-seq
MIRT2569532	hsa-miR-4648	CLIP-seq
MIRT1142775	hsa-miR-4663	CLIP-seq
MIRT2431102	hsa-miR-4666-3p	CLIP-seq
MIRT2569533	hsa-miR-4667-5p	CLIP-seq
MIRT2569534	hsa-miR-4676-3p	CLIP-seq
MIRT1142777	hsa-miR-4685-5p	CLIP-seq
MIRT2569535	hsa-miR-4687-3p	CLIP-seq
MIRT2569536	hsa-miR-4691-5p	CLIP-seq
MIRT1142778	hsa-miR-4699-3p	CLIP-seq
MIRT2569537	hsa-miR-4700-5p	CLIP-seq
MIRT2569538	hsa-miR-4701-3p	CLIP-seq
MIRT2390810	hsa-miR-4710	CLIP-seq
MIRT2569539	hsa-miR-4711-5p	CLIP-seq
MIRT2569540	hsa-miR-4720-5p	CLIP-seq
MIRT2569541	hsa-miR-4728-3p	CLIP-seq
MIRT2569542	hsa-miR-4742-3p	CLIP-seq
MIRT2569543	hsa-miR-4761-5p	CLIP-seq
MIRT2569544	hsa-miR-4776-5p	CLIP-seq
MIRT1142785	hsa-miR-4782-3p	CLIP-seq
MIRT2431103	hsa-miR-4789-5p	CLIP-seq
MIRT2390811	hsa-miR-4792	CLIP-seq
MIRT2431104	hsa-miR-4795-3p	CLIP-seq
MIRT2569545	hsa-miR-4799-3p	CLIP-seq
MIRT2569546	hsa-miR-486-5p	CLIP-seq
MIRT2569547	hsa-miR-491-5p	CLIP-seq
MIRT1142789	hsa-miR-499-5p	CLIP-seq
MIRT2569548	hsa-miR-5047	CLIP-seq
MIRT1142790	hsa-miR-507	CLIP-seq
MIRT1142791	hsa-miR-508-3p	CLIP-seq
MIRT2569549	hsa-miR-509-3p	CLIP-seq
MIRT2569550	hsa-miR-520d-5p	CLIP-seq
MIRT2569551	hsa-miR-524-5p	CLIP-seq
MIRT2569552	hsa-miR-526b	CLIP-seq
MIRT2569553	hsa-miR-548b-3p	CLIP-seq
MIRT2569554	hsa-miR-548g	CLIP-seq
MIRT1142796	hsa-miR-557	CLIP-seq
MIRT2569555	hsa-miR-578	CLIP-seq
MIRT2569556	hsa-miR-579	CLIP-seq
MIRT2569557	hsa-miR-582-5p	CLIP-seq
MIRT1142799	hsa-miR-586	CLIP-seq
MIRT2569558	hsa-miR-587	CLIP-seq
MIRT2390812	hsa-miR-613	CLIP-seq
MIRT2569559	hsa-miR-628-5p	CLIP-seq
MIRT2569560	hsa-miR-637	CLIP-seq
MIRT2569561	hsa-miR-647	CLIP-seq
MIRT1142801	hsa-miR-648	CLIP-seq
MIRT2569562	hsa-miR-655	CLIP-seq
MIRT2569563	hsa-miR-660	CLIP-seq
MIRT2390813	hsa-miR-665	CLIP-seq
MIRT1142805	hsa-miR-934	CLIP-seq
MIRT2390807	hsa-miR-1	CLIP-seq
MIRT2569496	hsa-miR-1208	CLIP-seq
MIRT2569497	hsa-miR-1225-5p	CLIP-seq
MIRT2569498	hsa-miR-1228	CLIP-seq
MIRT1142724	hsa-miR-1256	CLIP-seq
MIRT2569499	hsa-miR-1262	CLIP-seq
MIRT2569500	hsa-miR-1293	CLIP-seq
MIRT1142726	hsa-miR-129-5p	CLIP-seq
MIRT2569501	hsa-miR-1301	CLIP-seq
MIRT1142729	hsa-miR-145	CLIP-seq
MIRT1142732	hsa-miR-1910	CLIP-seq
MIRT2569502	hsa-miR-193a-5p	CLIP-seq
MIRT2569503	hsa-miR-1976	CLIP-seq
MIRT2390808	hsa-miR-198	CLIP-seq
MIRT1142733	hsa-miR-19a	CLIP-seq
MIRT1142734	hsa-miR-19b	CLIP-seq
MIRT2390809	hsa-miR-206	CLIP-seq
MIRT1142739	hsa-miR-219-5p	CLIP-seq
MIRT2569504	hsa-miR-221	CLIP-seq
MIRT2569505	hsa-miR-222	CLIP-seq
MIRT1142740	hsa-miR-2392	CLIP-seq
MIRT2569506	hsa-miR-28-3p	CLIP-seq
MIRT2431099	hsa-miR-300	CLIP-seq
MIRT2569508	hsa-miR-3147	CLIP-seq
MIRT1142745	hsa-miR-3151	CLIP-seq
MIRT2569509	hsa-miR-3170	CLIP-seq
MIRT1142747	hsa-miR-3180	CLIP-seq
MIRT1142748	hsa-miR-3180-3p	CLIP-seq
MIRT1142749	hsa-miR-3180-5p	CLIP-seq
MIRT1142750	hsa-miR-3189-3p	CLIP-seq
MIRT1142752	hsa-miR-3196	CLIP-seq
MIRT2569510	hsa-miR-3199	CLIP-seq
MIRT2569511	hsa-miR-331-3p	CLIP-seq
MIRT2569512	hsa-miR-3613-3p	CLIP-seq
MIRT2569513	hsa-miR-3614-3p	CLIP-seq
MIRT1142756	hsa-miR-3618	CLIP-seq
MIRT2569514	hsa-miR-3619-3p	CLIP-seq
MIRT2569515	hsa-miR-3653	CLIP-seq
MIRT2569516	hsa-miR-3658	CLIP-seq
MIRT2569517	hsa-miR-3679-3p	CLIP-seq
MIRT2040657	hsa-miR-369-3p	CLIP-seq
MIRT2569518	hsa-miR-374c	CLIP-seq
MIRT2431100	hsa-miR-378g	CLIP-seq
MIRT2431101	hsa-miR-381	CLIP-seq
MIRT1142761	hsa-miR-4282	CLIP-seq
MIRT2569520	hsa-miR-4289	CLIP-seq
MIRT2569521	hsa-miR-4297	CLIP-seq
MIRT1142762	hsa-miR-4302	CLIP-seq
MIRT2569523	hsa-miR-4425	CLIP-seq
MIRT1142765	hsa-miR-4432	CLIP-seq
MIRT1142766	hsa-miR-4445	CLIP-seq
MIRT1142767	hsa-miR-4448	CLIP-seq
MIRT1142768	hsa-miR-4468	CLIP-seq
MIRT1142769	hsa-miR-4477a	CLIP-seq
MIRT2569526	hsa-miR-4483	CLIP-seq
MIRT2569528	hsa-miR-450a	CLIP-seq
MIRT1142771	hsa-miR-450b-5p	CLIP-seq
MIRT2569529	hsa-miR-4511	CLIP-seq
MIRT2569530	hsa-miR-452	CLIP-seq
MIRT2569531	hsa-miR-4535	CLIP-seq
MIRT1142773	hsa-miR-4641	CLIP-seq
MIRT1142774	hsa-miR-4642	CLIP-seq
MIRT2569532	hsa-miR-4648	CLIP-seq
MIRT1142775	hsa-miR-4663	CLIP-seq
MIRT2431102	hsa-miR-4666-3p	CLIP-seq
MIRT2569533	hsa-miR-4667-5p	CLIP-seq
MIRT2569534	hsa-miR-4676-3p	CLIP-seq
MIRT1142777	hsa-miR-4685-5p	CLIP-seq
MIRT2569535	hsa-miR-4687-3p	CLIP-seq
MIRT2569536	hsa-miR-4691-5p	CLIP-seq
MIRT1142778	hsa-miR-4699-3p	CLIP-seq
MIRT2569537	hsa-miR-4700-5p	CLIP-seq
MIRT2569538	hsa-miR-4701-3p	CLIP-seq
MIRT2390810	hsa-miR-4710	CLIP-seq
MIRT2569539	hsa-miR-4711-5p	CLIP-seq
MIRT2569540	hsa-miR-4720-5p	CLIP-seq
MIRT2569542	hsa-miR-4742-3p	CLIP-seq
MIRT2569543	hsa-miR-4761-5p	CLIP-seq
MIRT2569544	hsa-miR-4776-5p	CLIP-seq
MIRT1142785	hsa-miR-4782-3p	CLIP-seq
MIRT2431103	hsa-miR-4789-5p	CLIP-seq
MIRT2390811	hsa-miR-4792	CLIP-seq
MIRT2431104	hsa-miR-4795-3p	CLIP-seq
MIRT2569545	hsa-miR-4799-3p	CLIP-seq
MIRT2569546	hsa-miR-486-5p	CLIP-seq
MIRT1142789	hsa-miR-499-5p	CLIP-seq
MIRT2569548	hsa-miR-5047	CLIP-seq
MIRT1142790	hsa-miR-507	CLIP-seq
MIRT1142791	hsa-miR-508-3p	CLIP-seq
MIRT2569549	hsa-miR-509-3p	CLIP-seq
MIRT2569550	hsa-miR-520d-5p	CLIP-seq
MIRT2569551	hsa-miR-524-5p	CLIP-seq
MIRT2569552	hsa-miR-526b	CLIP-seq
MIRT2569553	hsa-miR-548b-3p	CLIP-seq
MIRT2569554	hsa-miR-548g	CLIP-seq
MIRT1142796	hsa-miR-557	CLIP-seq
MIRT2569555	hsa-miR-578	CLIP-seq
MIRT2569556	hsa-miR-579	CLIP-seq
MIRT2569557	hsa-miR-582-5p	CLIP-seq
MIRT1142799	hsa-miR-586	CLIP-seq
MIRT2569558	hsa-miR-587	CLIP-seq
MIRT2390812	hsa-miR-613	CLIP-seq
MIRT2569560	hsa-miR-637	CLIP-seq
MIRT2569561	hsa-miR-647	CLIP-seq
MIRT1142801	hsa-miR-648	CLIP-seq
MIRT2569562	hsa-miR-655	CLIP-seq
MIRT2569563	hsa-miR-660	CLIP-seq
MIRT2390813	hsa-miR-665	CLIP-seq
MIRT1142805	hsa-miR-934	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ELF1	Activation	20600580
PBX2	Unknown	24617557
PKNOX1	Unknown	12732210

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IBA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001525	Process	Angiogenesis	IBA
GO:0001525	Process	Angiogenesis	IEA
GO:0001654	Process	Eye development	IBA
GO:0002089	Process	Lens morphogenesis in camera-type eye	IEA
GO:0003677	Function	DNA binding	IDA	26550823
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0005515	Function	Protein binding	IPI	18692240, 19559479, 20159610, 20211142, 20541704
GO:0005634	Component	Nucleus	IEA
GO:0005667	Component	Transcription regulator complex	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0007420	Process	Brain development	IBA
GO:0007626	Process	Locomotory behavior	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IBA
GO:0009880	Process	Embryonic pattern specification	IBA
GO:0009887	Process	Animal organ morphogenesis	IBA
GO:0030097	Process	Hemopoiesis	IBA
GO:0030097	Process	Hemopoiesis	IEA
GO:0035855	Process	Megakaryocyte development	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045638	Process	Negative regulation of myeloid cell differentiation	IEA
GO:0045638	Process	Negative regulation of myeloid cell differentiation	ISS
GO:0045665	Process	Negative regulation of neuron differentiation	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0048514	Process	Blood vessel morphogenesis	IEA
GO:0060216	Process	Definitive hemopoiesis	IEA
GO:0061049	Process	Cell growth involved in cardiac muscle cell development	IEA

Other IDs

• MIM: 601739
• HGNC: 7000
• e!Ensembl: ENSG00000143995

Protein

• UniProt ID: O00470
• Protein name: Homeobox protein Meis1
• Protein function: Acts as a transcriptional regulator of PAX6. Acts as a transcriptional activator of PF4 in complex with PBX1 or PBX2. Required for hematopoiesis, megakaryocyte lineage development and vascular patterning. May function as a cofactor for HOXA7 and
• PDB: 4XRS, 5EGO
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF16493	Meis_PKNOX_N	108 → 192	N-terminal of Homeobox Meis and PKNOX1	Family
  PF05920	Homeobox_KN	290 → 329	Homeobox KN domain	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed at low level in normal immunohepatopoietic tissues, including the fetal liver. Expressed in a subset of myeloid leukemia cell lines, with the highest expression seen in those with a megakaryocytic-erythroid phenotype. Also ex
• Sequence:

  MAQRYDDLPHYGGMDGVGIPSTMYGDPHAARSMQPVHHLNHGPPLHSHQYPHTAHTNAMA
  PSMGSSVNDALKRDKDAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNED
  IAVFAKQIRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGK
  MPIDLVIDDREGGSKSDSEDITRSANLTDQPSWNRDHDDTASTRSGGTPGPSSGGHTSHS
  GDNSSEQGDGLDNSVASPSTGDDDDPDKDKKRHKKRGIFPKVATNIMRAWLFQHLTHPYP
  SEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGTPYNPDGQPMGGFVM
  DGQQHMGIRAPGPMSGMGMNMGMEGQWHYM

• Sequence length: 390

Pathways

KEGG:

Signaling pathways regulating pluripotency of stem cells
Transcriptional misregulation in cancer

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLONAL HEMATOPOIESIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MEIS1-related disorder	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOVEMENT DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIODIC LIMB MOVEMENT DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESTLESS LEGS SYNDROME	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SLEEP APNEA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SLEEP DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute leukemia	Leukemia	BEFREE	19620287, 21518888, 24022755, 26059450, 27258906		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	11314021, 12358913, 22185299		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	19563517, 22305570		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	10602420		★☆☆☆☆ Found in Text Mining only
Acute Undifferentiated Leukemia	Leukemia	BEFREE	17942707, 20541704, 28411381		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	33776902	Associate	★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	22185299		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	11094311		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	27583552		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	14614318, 19776672		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	19776672		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19776672	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	22143938	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	28599093		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	33757590	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	28425489		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	28425489	Associate	★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	22185299		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	11094311		★☆☆☆☆ Found in Text Mining only
Chronic Insomnia	Insomnia	CTD_human_DG	28604731		★☆☆☆☆ Found in Text Mining only
Chronic Insomnia	Insomnia	BEFREE	30215811		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	21572129		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	11157742		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	24244575		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	24244575	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	21858198, 24244575		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24244575	Associate	★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	11314021, 25585874		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	26643377		★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Development Disorder	BEFREE	17637780		★☆☆☆☆ Found in Text Mining only
Dyssomnias	Dyssomnia	BEFREE	28695622		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	GWASCAT_DG	27506219		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epithelioma	Epithelioma	BEFREE	24244575		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	26314854	Inhibit	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	28462489, 31090196, 32819319, 40211274	Associate	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	30496486		★☆☆☆☆ Found in Text Mining only
Gilles de la Tourette syndrome	Tourette Syndrome	BEFREE	19822783		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	38563293	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	21858198		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	33539429	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	38563293	Stimulate	★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	21572129	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	21572129		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	33574497	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	11161815, 14966272, 15103390, 15744344, 17671196, 17712416, 19109563, 19155294, 21741595, 22185299, 22353710, 22508837, 24022755, 24612037, 25740828, 25911551, 26927674, 27018596, 27123834, 27617578, 27619068, 28054140, 28229434, 28399410, 28411381, 29592525, 30384975, 30670779, 31413090, 7565694, 9049632		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	17805329		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	20600580, 22185299, 23818607, 24858818, 27317766, 31855575, 33924850, 36455589, 38048593	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	10996203, 22096027, 26397705, 26434589, 28830460, 31210592, 32764680, 34502319, 35212611, 35709529, 36455613, 38048593	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10602420, 10996203, 11157742, 11314021, 12543865, 15103390, 15479723, 16914901, 17589499, 18308931, 18410541, 19563517, 22305570, 22885519, 24258712, 24307265, 25349154, 25585874, 25795706, 25901794, 26434589, 26517931, 26642852, 26747896, 27063597, 27617578, 27619068, 28049638, 28054140, 28270206, 28288143, 28399410, 28664166, 29217774, 30384975, 31031188, 31768018		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	15103390, 18410541		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26314854	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	14614318, 19776672		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	19776672		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	22723371, 29716922, 30560549		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11161815, 27346355, 28322463, 28745213, 31090196		★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	27333032		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	19776672		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	19776672		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	19776672		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	11094311		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	14614318		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	31413090		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	26643377		★☆☆☆☆ Found in Text Mining only
Microphthalmos	Microphthalmos	BEFREE	26253404		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	26643377		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	31484947	Associate	★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	18195096		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	10602420, 15958703, 18604245, 9049632, 9226379		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19825192, 24244575, 25585874, 28322463, 28462489, 29716922, 7565694		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	24617557		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	11094311, 11161815, 12880965, 18195096, 20018718		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	20018718	Associate	★☆☆☆☆ Found in Text Mining only
Nonorganic Insomnia	Nonorganic Insomnia	CTD_human_DG	28604731		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	37674251	Associate	★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	26059450		★☆☆☆☆ Found in Text Mining only
Primary Insomnia	Insomnia	CTD_human_DG	28604731		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	22723371, 29716922, 30560549		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	22723371	Inhibit	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	25158280, 29716922		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	29716922, 32540218, 32681068	Associate	★☆☆☆☆ Found in Text Mining only
Psychophysiological Insomnia	Psychophysiological Insomnia	CTD_human_DG	28604731		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	34012494	Associate	★☆☆☆☆ Found in Text Mining only
Restless Legs Syndrome	Restless Legs Syndrome	BEFREE	17637780, 18541116, 19126776, 19181647, 19279021, 21572129, 21710629, 21925394, 24995868, 25817513, 26498236, 26643377, 28236139, 28425489, 28604731, 28626420, 28645892, 28695622, 29029846, 30111810, 30215811, 30233336, 31551905		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Restless Legs Syndrome	Restless Legs Syndrome	GWASCAT_DG	17637780, 21779176, 29029846		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Restless Legs Syndrome	Restless Legs Syndrome	CTD_human_DG	17637780, 28604731		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Restless Legs Syndrome	Restless Legs Syndrome	GWASDB_DG	17637780, 21779176		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Restless Legs Syndrome	Willis-ekbom disease	Pubtator	19126776, 19181647, 19279021, 21572129, 21925394, 25142570, 25817513, 26498236, 28425489, 28604731, 30111810, 31725784, 34888668	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	30720533, 33574497	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	30179902, 33574497	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	30496486	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Disorders	Sleep Disorders	BEFREE	28695622		★☆☆☆☆ Found in Text Mining only
Sleep Initiation and Maintenance Disorders	Sleep Disorders	GWASCAT_DG	28604731		★☆☆☆☆ Found in Text Mining only
Sleep Initiation and Maintenance Disorders	Sleep Disorders	CTD_human_DG	28604731		★☆☆☆☆ Found in Text Mining only
Sleep Initiation Dysfunction	Sleep Disorders	CTD_human_DG	28604731		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	26314854, 28462489		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	25186767	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	19776672	Associate	★☆☆☆☆ Found in Text Mining only