MDK (midkine)

Gene

• Entrez ID: 4192
• Gene name: Midkine
• Gene symbol: MDK
• Synonyms (NCBI Gene): ARAP, MK, NEGF2
• Chromosome: 11
• Chromosome location: 11p11.2
• Summary: This gene encodes a member of a small family of secreted growth factors that binds heparin and responds to retinoic acid. The encoded protein promotes cell growth, migration, and angiogenesis, in particular during tumorigenesis. This gene has been targete

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT022440	hsa-miR-124-3p	Microarray	18668037
MIRT050887	hsa-miR-17-5p	CLASH	23622248
MIRT040730	hsa-miR-92b-3p	CLASH	23622248
MIRT036299	hsa-miR-1229-3p	CLASH	23622248
MIRT022440	hsa-miR-124-3p	PAR-CLIP	27292025
MIRT1138628	hsa-miR-1275	CLIP-seq
MIRT1138629	hsa-miR-1470	CLIP-seq
MIRT1138630	hsa-miR-188-5p	CLIP-seq
MIRT1138631	hsa-miR-2110	CLIP-seq
MIRT1138632	hsa-miR-219-2-3p	CLIP-seq
MIRT1138633	hsa-miR-223	CLIP-seq
MIRT1138634	hsa-miR-23a	CLIP-seq
MIRT1138635	hsa-miR-23b	CLIP-seq
MIRT1138636	hsa-miR-23c	CLIP-seq
MIRT1138637	hsa-miR-2467-5p	CLIP-seq
MIRT1138638	hsa-miR-3148	CLIP-seq
MIRT1138639	hsa-miR-3151	CLIP-seq
MIRT1138640	hsa-miR-3192	CLIP-seq
MIRT1138641	hsa-miR-3199	CLIP-seq
MIRT1138642	hsa-miR-326	CLIP-seq
MIRT1138643	hsa-miR-330-5p	CLIP-seq
MIRT1138644	hsa-miR-4260	CLIP-seq
MIRT1138645	hsa-miR-4265	CLIP-seq
MIRT1138646	hsa-miR-4271	CLIP-seq
MIRT1138647	hsa-miR-4286	CLIP-seq
MIRT1138648	hsa-miR-4296	CLIP-seq
MIRT1138649	hsa-miR-4314	CLIP-seq
MIRT1138650	hsa-miR-4322	CLIP-seq
MIRT1138651	hsa-miR-4328	CLIP-seq
MIRT1138652	hsa-miR-4447	CLIP-seq
MIRT1138653	hsa-miR-4472	CLIP-seq
MIRT1138654	hsa-miR-4525	CLIP-seq
MIRT1138655	hsa-miR-4646-3p	CLIP-seq
MIRT1138656	hsa-miR-4646-5p	CLIP-seq
MIRT1138657	hsa-miR-4665-5p	CLIP-seq
MIRT1138658	hsa-miR-4667-3p	CLIP-seq
MIRT1138659	hsa-miR-4668-5p	CLIP-seq
MIRT1138660	hsa-miR-4723-5p	CLIP-seq
MIRT1138661	hsa-miR-4725-3p	CLIP-seq
MIRT1138662	hsa-miR-4780	CLIP-seq
MIRT1138663	hsa-miR-491-5p	CLIP-seq
MIRT1138664	hsa-miR-623	CLIP-seq
MIRT1138665	hsa-miR-625	CLIP-seq
MIRT1138666	hsa-miR-760	CLIP-seq
MIRT1138667	hsa-miR-124	CLIP-seq
MIRT1138628	hsa-miR-1275	CLIP-seq
MIRT1138631	hsa-miR-2110	CLIP-seq
MIRT1138632	hsa-miR-219-2-3p	CLIP-seq
MIRT1138633	hsa-miR-223	CLIP-seq
MIRT1138638	hsa-miR-3148	CLIP-seq
MIRT1138639	hsa-miR-3151	CLIP-seq
MIRT1138640	hsa-miR-3192	CLIP-seq
MIRT1138641	hsa-miR-3199	CLIP-seq
MIRT1138642	hsa-miR-326	CLIP-seq
MIRT1138643	hsa-miR-330-5p	CLIP-seq
MIRT1138645	hsa-miR-4265	CLIP-seq
MIRT1138646	hsa-miR-4271	CLIP-seq
MIRT1138648	hsa-miR-4296	CLIP-seq
MIRT1138649	hsa-miR-4314	CLIP-seq
MIRT1138650	hsa-miR-4322	CLIP-seq
MIRT1138651	hsa-miR-4328	CLIP-seq
MIRT1138652	hsa-miR-4447	CLIP-seq
MIRT1138653	hsa-miR-4472	CLIP-seq
MIRT1138656	hsa-miR-4646-5p	CLIP-seq
MIRT1138657	hsa-miR-4665-5p	CLIP-seq
MIRT1138659	hsa-miR-4668-5p	CLIP-seq
MIRT1138661	hsa-miR-4725-3p	CLIP-seq
MIRT1138663	hsa-miR-491-5p	CLIP-seq
MIRT1138668	hsa-miR-506	CLIP-seq
MIRT1138665	hsa-miR-625	CLIP-seq
MIRT1138666	hsa-miR-760	CLIP-seq
MIRT1138669	hsa-miR-939	CLIP-seq
MIRT1138628	hsa-miR-1275	CLIP-seq
MIRT1138631	hsa-miR-2110	CLIP-seq
MIRT1138632	hsa-miR-219-2-3p	CLIP-seq
MIRT1138633	hsa-miR-223	CLIP-seq
MIRT1138638	hsa-miR-3148	CLIP-seq
MIRT1138639	hsa-miR-3151	CLIP-seq
MIRT1138640	hsa-miR-3192	CLIP-seq
MIRT1138641	hsa-miR-3199	CLIP-seq
MIRT1138642	hsa-miR-326	CLIP-seq
MIRT1138643	hsa-miR-330-5p	CLIP-seq
MIRT1138645	hsa-miR-4265	CLIP-seq
MIRT1138646	hsa-miR-4271	CLIP-seq
MIRT1138648	hsa-miR-4296	CLIP-seq
MIRT1138649	hsa-miR-4314	CLIP-seq
MIRT1138650	hsa-miR-4322	CLIP-seq
MIRT1138651	hsa-miR-4328	CLIP-seq
MIRT1138652	hsa-miR-4447	CLIP-seq
MIRT1138653	hsa-miR-4472	CLIP-seq
MIRT1138656	hsa-miR-4646-5p	CLIP-seq
MIRT1138657	hsa-miR-4665-5p	CLIP-seq
MIRT1138659	hsa-miR-4668-5p	CLIP-seq
MIRT1138661	hsa-miR-4725-3p	CLIP-seq
MIRT1138663	hsa-miR-491-5p	CLIP-seq
MIRT1138665	hsa-miR-625	CLIP-seq
MIRT1138666	hsa-miR-760	CLIP-seq
MIRT1138669	hsa-miR-939	CLIP-seq
MIRT1138667	hsa-miR-124	CLIP-seq
MIRT1138628	hsa-miR-1275	CLIP-seq
MIRT1138631	hsa-miR-2110	CLIP-seq
MIRT1138632	hsa-miR-219-2-3p	CLIP-seq
MIRT1138634	hsa-miR-23a	CLIP-seq
MIRT1138635	hsa-miR-23b	CLIP-seq
MIRT1138636	hsa-miR-23c	CLIP-seq
MIRT1138639	hsa-miR-3151	CLIP-seq
MIRT2269416	hsa-miR-3189-3p	CLIP-seq
MIRT1138640	hsa-miR-3192	CLIP-seq
MIRT1138641	hsa-miR-3199	CLIP-seq
MIRT1138642	hsa-miR-326	CLIP-seq
MIRT1138643	hsa-miR-330-5p	CLIP-seq
MIRT1138645	hsa-miR-4265	CLIP-seq
MIRT1138646	hsa-miR-4271	CLIP-seq
MIRT1138648	hsa-miR-4296	CLIP-seq
MIRT1138649	hsa-miR-4314	CLIP-seq
MIRT1138650	hsa-miR-4322	CLIP-seq
MIRT1138652	hsa-miR-4447	CLIP-seq
MIRT2269417	hsa-miR-4448	CLIP-seq
MIRT1138653	hsa-miR-4472	CLIP-seq
MIRT2269418	hsa-miR-4642	CLIP-seq
MIRT2269419	hsa-miR-4645-5p	CLIP-seq
MIRT1138656	hsa-miR-4646-5p	CLIP-seq
MIRT1138657	hsa-miR-4665-5p	CLIP-seq
MIRT2269420	hsa-miR-4673	CLIP-seq
MIRT1138661	hsa-miR-4725-3p	CLIP-seq
MIRT2269421	hsa-miR-4733-3p	CLIP-seq
MIRT1138663	hsa-miR-491-5p	CLIP-seq
MIRT1138668	hsa-miR-506	CLIP-seq
MIRT2269422	hsa-miR-541	CLIP-seq
MIRT1138665	hsa-miR-625	CLIP-seq
MIRT1138666	hsa-miR-760	CLIP-seq
MIRT1138669	hsa-miR-939	CLIP-seq
MIRT1138628	hsa-miR-1275	CLIP-seq
MIRT1138629	hsa-miR-1470	CLIP-seq
MIRT1138630	hsa-miR-188-5p	CLIP-seq
MIRT1138634	hsa-miR-23a	CLIP-seq
MIRT1138635	hsa-miR-23b	CLIP-seq
MIRT1138636	hsa-miR-23c	CLIP-seq
MIRT1138637	hsa-miR-2467-5p	CLIP-seq
MIRT1138644	hsa-miR-4260	CLIP-seq
MIRT1138647	hsa-miR-4286	CLIP-seq
MIRT1138654	hsa-miR-4525	CLIP-seq
MIRT1138655	hsa-miR-4646-3p	CLIP-seq
MIRT1138657	hsa-miR-4665-5p	CLIP-seq
MIRT1138658	hsa-miR-4667-3p	CLIP-seq
MIRT1138660	hsa-miR-4723-5p	CLIP-seq
MIRT1138662	hsa-miR-4780	CLIP-seq
MIRT1138664	hsa-miR-623	CLIP-seq
MIRT1138665	hsa-miR-625	CLIP-seq
MIRT2269416	hsa-miR-3189-3p	CLIP-seq
MIRT2269417	hsa-miR-4448	CLIP-seq
MIRT2269418	hsa-miR-4642	CLIP-seq
MIRT2269419	hsa-miR-4645-5p	CLIP-seq
MIRT2269420	hsa-miR-4673	CLIP-seq
MIRT2269421	hsa-miR-4733-3p	CLIP-seq
MIRT1138628	hsa-miR-1275	CLIP-seq
MIRT1138629	hsa-miR-1470	CLIP-seq
MIRT1138630	hsa-miR-188-5p	CLIP-seq
MIRT1138634	hsa-miR-23a	CLIP-seq
MIRT1138635	hsa-miR-23b	CLIP-seq
MIRT1138636	hsa-miR-23c	CLIP-seq
MIRT1138637	hsa-miR-2467-5p	CLIP-seq
MIRT1138639	hsa-miR-3151	CLIP-seq
MIRT2269416	hsa-miR-3189-3p	CLIP-seq
MIRT1138644	hsa-miR-4260	CLIP-seq
MIRT1138647	hsa-miR-4286	CLIP-seq
MIRT2269417	hsa-miR-4448	CLIP-seq
MIRT1138654	hsa-miR-4525	CLIP-seq
MIRT2269418	hsa-miR-4642	CLIP-seq
MIRT2269419	hsa-miR-4645-5p	CLIP-seq
MIRT1138655	hsa-miR-4646-3p	CLIP-seq
MIRT1138657	hsa-miR-4665-5p	CLIP-seq
MIRT1138658	hsa-miR-4667-3p	CLIP-seq
MIRT2269420	hsa-miR-4673	CLIP-seq
MIRT1138660	hsa-miR-4723-5p	CLIP-seq
MIRT2269421	hsa-miR-4733-3p	CLIP-seq
MIRT1138662	hsa-miR-4780	CLIP-seq
MIRT1138664	hsa-miR-623	CLIP-seq
MIRT1138665	hsa-miR-625	CLIP-seq
MIRT1138669	hsa-miR-939	CLIP-seq
MIRT1138628	hsa-miR-1275	CLIP-seq
MIRT1138629	hsa-miR-1470	CLIP-seq
MIRT1138630	hsa-miR-188-5p	CLIP-seq
MIRT1138634	hsa-miR-23a	CLIP-seq
MIRT1138635	hsa-miR-23b	CLIP-seq
MIRT1138636	hsa-miR-23c	CLIP-seq
MIRT1138637	hsa-miR-2467-5p	CLIP-seq
MIRT1138639	hsa-miR-3151	CLIP-seq
MIRT2269416	hsa-miR-3189-3p	CLIP-seq
MIRT1138644	hsa-miR-4260	CLIP-seq
MIRT1138647	hsa-miR-4286	CLIP-seq
MIRT2269417	hsa-miR-4448	CLIP-seq
MIRT1138654	hsa-miR-4525	CLIP-seq
MIRT2269418	hsa-miR-4642	CLIP-seq
MIRT2269419	hsa-miR-4645-5p	CLIP-seq
MIRT1138655	hsa-miR-4646-3p	CLIP-seq
MIRT1138657	hsa-miR-4665-5p	CLIP-seq
MIRT1138658	hsa-miR-4667-3p	CLIP-seq
MIRT2269420	hsa-miR-4673	CLIP-seq
MIRT1138660	hsa-miR-4723-5p	CLIP-seq
MIRT2269421	hsa-miR-4733-3p	CLIP-seq
MIRT1138662	hsa-miR-4780	CLIP-seq
MIRT1138664	hsa-miR-623	CLIP-seq
MIRT1138665	hsa-miR-625	CLIP-seq
MIRT1138669	hsa-miR-939	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001662	Process	Behavioral fear response	IEA
GO:0002232	Process	Leukocyte chemotaxis involved in inflammatory response	IEA
GO:0002232	Process	Leukocyte chemotaxis involved in inflammatory response	IMP	10683378
GO:0002232	Process	Leukocyte chemotaxis involved in inflammatory response	ISS
GO:0002286	Process	T cell activation involved in immune response	IEA
GO:0002286	Process	T cell activation involved in immune response	ISS
GO:0002690	Process	Positive regulation of leukocyte chemotaxis	IEA
GO:0002690	Process	Positive regulation of leukocyte chemotaxis	ISS
GO:0005515	Function	Protein binding	IPI	10212223, 10772929, 12084985, 12147681, 12573468, 15466886, 18469519, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0007010	Process	Cytoskeleton organization	IEA
GO:0007010	Process	Cytoskeleton organization	ISS
GO:0007162	Process	Negative regulation of cell adhesion	IEA
GO:0007162	Process	Negative regulation of cell adhesion	ISS
GO:0007165	Process	Signal transduction	NAS	7835084
GO:0007399	Process	Nervous system development	NAS	9384573
GO:0007614	Process	Short-term memory	IEA
GO:0008083	Function	Growth factor activity	IBA
GO:0008083	Function	Growth factor activity	IEA
GO:0008083	Function	Growth factor activity	NAS	1639750
GO:0008201	Function	Heparin binding	IDA	9384573
GO:0008201	Function	Heparin binding	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009611	Process	Response to wounding	IEA
GO:0009611	Process	Response to wounding	ISS
GO:0009725	Process	Response to hormone	IEA
GO:0010667	Process	Negative regulation of cardiac muscle cell apoptotic process	IEA
GO:0010667	Process	Negative regulation of cardiac muscle cell apoptotic process	IMP	19060126
GO:0010667	Process	Negative regulation of cardiac muscle cell apoptotic process	ISS
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	IMP	18469519
GO:0010759	Process	Positive regulation of macrophage chemotaxis	IEA
GO:0010759	Process	Positive regulation of macrophage chemotaxis	IMP	10683378
GO:0010759	Process	Positive regulation of macrophage chemotaxis	ISS
GO:0010838	Process	Positive regulation of keratinocyte proliferation	IDA	18469519
GO:0010976	Process	Positive regulation of neuron projection development	IDA	12084985
GO:0010976	Process	Positive regulation of neuron projection development	IMP	15466886
GO:0010996	Process	Response to auditory stimulus	IEA
GO:0010996	Process	Response to auditory stimulus	ISS
GO:0016477	Process	Cell migration	IEA
GO:0021542	Process	Dentate gyrus development	IEA
GO:0021681	Process	Cerebellar granular layer development	IEA
GO:0021766	Process	Hippocampus development	IEA
GO:0021987	Process	Cerebral cortex development	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030154	Process	Cell differentiation	NAS	1639750
GO:0030279	Process	Negative regulation of ossification	IEA
GO:0030279	Process	Negative regulation of ossification	ISS
GO:0030325	Process	Adrenal gland development	IEA
GO:0030325	Process	Adrenal gland development	ISS
GO:0030335	Process	Positive regulation of cell migration	IDA	15466886
GO:0030421	Process	Defecation	IEA
GO:0031012	Component	Extracellular matrix	HDA	28327460
GO:0032330	Process	Regulation of chondrocyte differentiation	IEA
GO:0032330	Process	Regulation of chondrocyte differentiation	ISS
GO:0032735	Process	Positive regulation of interleukin-12 production	IMP	22323540
GO:0035374	Function	Chondroitin sulfate binding	IEA
GO:0035374	Function	Chondroitin sulfate binding	ISS
GO:0035556	Process	Intracellular signal transduction	IDA	18469519
GO:0042246	Process	Tissue regeneration	IEA
GO:0042246	Process	Tissue regeneration	ISS
GO:0042995	Component	Cell projection	IEA
GO:0043524	Process	Negative regulation of neuron apoptotic process	IDA	12573468
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0044849	Process	Estrous cycle	IEA
GO:0044849	Process	Estrous cycle	ISS
GO:0045582	Process	Positive regulation of T cell differentiation	IEA
GO:0045582	Process	Positive regulation of T cell differentiation	ISS
GO:0045590	Process	Negative regulation of regulatory T cell differentiation	IMP	22323540
GO:0045785	Process	Positive regulation of cell adhesion	IDA	12084985
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0046850	Process	Regulation of bone remodeling	IEA
GO:0046850	Process	Regulation of bone remodeling	ISS
GO:0048477	Process	Oogenesis	IEA
GO:0048477	Process	Oogenesis	ISS
GO:0048714	Process	Positive regulation of oligodendrocyte differentiation	IDA	27445335
GO:0048714	Process	Positive regulation of oligodendrocyte differentiation	IEA
GO:0050729	Process	Positive regulation of inflammatory response	IMP	22323540
GO:0050795	Process	Regulation of behavior	IEA
GO:0051384	Process	Response to glucocorticoid	IEA
GO:0051781	Process	Positive regulation of cell division	IEA
GO:0061036	Process	Positive regulation of cartilage development	IEA
GO:0061036	Process	Positive regulation of cartilage development	ISS
GO:0071673	Process	Positive regulation of smooth muscle cell chemotaxis	IMP	10683378
GO:0090023	Process	Positive regulation of neutrophil chemotaxis	IEA
GO:0090023	Process	Positive regulation of neutrophil chemotaxis	ISS
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	ISS
GO:0106015	Process	Negative regulation of inflammatory response to wounding	IEA
GO:0106015	Process	Negative regulation of inflammatory response to wounding	ISS
GO:0106016	Process	Positive regulation of inflammatory response to wounding	IEA
GO:0106016	Process	Positive regulation of inflammatory response to wounding	ISS
GO:0106091	Process	Glial cell projection elongation	IEA
GO:0106091	Process	Glial cell projection elongation	ISS
GO:1900026	Process	Positive regulation of substrate adhesion-dependent cell spreading	IEA
GO:1900026	Process	Positive regulation of substrate adhesion-dependent cell spreading	ISS
GO:1903039	Process	Positive regulation of leukocyte cell-cell adhesion	IMP	24458438
GO:1904036	Process	Negative regulation of epithelial cell apoptotic process	IEA
GO:1904036	Process	Negative regulation of epithelial cell apoptotic process	ISS
GO:1904399	Function	Heparan sulfate binding	IDA	12084985
GO:1904996	Process	Positive regulation of leukocyte adhesion to vascular endothelial cell	IEA
GO:1904996	Process	Positive regulation of leukocyte adhesion to vascular endothelial cell	ISS
GO:1905555	Process	Positive regulation of blood vessel branching	IMP	19060126
GO:1905564	Process	Positive regulation of vascular endothelial cell proliferation	IEA
GO:1905564	Process	Positive regulation of vascular endothelial cell proliferation	ISS
GO:1905653	Process	Positive regulation of artery morphogenesis	IEA
GO:1905653	Process	Positive regulation of artery morphogenesis	ISS
GO:2000179	Process	Positive regulation of neural precursor cell proliferation	IEA
GO:2000179	Process	Positive regulation of neural precursor cell proliferation	ISS
GO:2000347	Process	Positive regulation of hepatocyte proliferation	IEA
GO:2000347	Process	Positive regulation of hepatocyte proliferation	ISS
GO:2000391	Process	Positive regulation of neutrophil extravasation	IEA
GO:2000391	Process	Positive regulation of neutrophil extravasation	ISS
GO:2001224	Process	Positive regulation of neuron migration	IMP	10212223

Other IDs

• MIM: 162096
• HGNC: 6972
• e!Ensembl: ENSG00000110492

Protein

• UniProt ID: P21741
• Protein name: Midkine (MK) (Amphiregulin-associated protein) (ARAP) (Midgestation and kidney protein) (Neurite outgrowth-promoting factor 2) (Neurite outgrowth-promoting protein)
• Protein function: Secreted protein that functions as a cytokine and growth factor and mediates its signal through cell-surface proteoglycan and non-proteoglycan receptors (PubMed:10212223, PubMed:10772929, PubMed:12084985, PubMed:12122009, PubMed:12573468, PubMed
• PDB: 1MKC, 1MKN
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF05196	PTN_MK_N	24 → 80	PTN/MK heparin-binding protein family, N-terminal domain	Domain
  PF01091	PTN_MK_C	81 → 142	PTN/MK heparin-binding protein family, C-terminal domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in various tumor cell lines. In insulinoma tissue predominantly expressed in precancerous lesions. {ECO:0000269|PubMed:17379400}.
• Sequence:

  MQHRGFLLLTLLALLALTSAVAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGT
  CGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETI
  RVTKPCTPKTKAKAKAKKGKGKD

• Sequence length: 143

Pathways

Reactome:

NOTCH2 Activation and Transmission of Signal to the Nucleus

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANXIETY DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN ISCHEMIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHIES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MEMORY DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MESOTHELIOMA, MALIGNANT	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute leukemia	Leukemia	BEFREE	17267033, 19409372		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	17267033, 20544404		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	27992669, 29208250		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	25017879, 29355490		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	23976985		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	10408712		★☆☆☆☆ Found in Text Mining only
Adult Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	16211240		★☆☆☆☆ Found in Text Mining only
Age-Related Memory Disorders	Age-Related Memory Disorders	CTD_human_DG	19217924		★☆☆☆☆ Found in Text Mining only
Alveolar Soft Part Sarcoma	Alveolar Sarcoma	BEFREE	21552147		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	39380021	Associate	★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	Pubtator	22986245, 29383694	Associate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	21632553, 24567526		★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	BEFREE	31648221		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	CTD_human_DG	19217924		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety States, Neurotic	Anxiety Disorder	CTD_human_DG	19217924		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	27530994		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	28781288		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	15146411		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	10331431		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	23349846	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	28781288		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	29164967		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	27903979		★☆☆☆☆ Found in Text Mining only
Biliary Tract Cancer	Biliary Tract Cancer	BEFREE	29344648		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	14613994, 17919690, 8653688		★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	LHGDN	12127679		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Neoplasms	Brain Neoplasms	BEFREE	10331431		★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	BEFREE	1883381		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10331431, 15138367, 26159850, 7520350		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	26159850, 27511357, 36594100	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	10408712, 15160348, 17622248, 22099874, 27511357, 29176691	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10408712, 11048798, 19152444, 20603890, 28918838, 8383007, 9241309, 9716029		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	12966430, 15160348, 26414287, 27813495	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	23719264	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	10752993, 14613994, 17919690, 8653688		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	10331431, 23976985		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	24567526	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	36438481	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	11489832, 22249249		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	LHGDN	18195496		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	12648577, 15368588		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	12648577, 15368588		★☆☆☆☆ Found in Text Mining only
Child Development Disorders, Pervasive	Development Disorder	GWASCAT_DG	28540026		★☆☆☆☆ Found in Text Mining only
Childhood Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	16211240		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	29486735		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	29486735	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	28963279		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	24043271		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	15050737, 15578698		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	15050737		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	10408712, 12175547, 27692729, 8844985		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	10408712, 22562257	Associate	★☆☆☆☆ Found in Text Mining only
Cone-Rod Dystrophy 2	Cone-rod dystrophy	BEFREE	31552013		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	27692729, 30217121		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	23815177		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	LHGDN	17607302		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathy	Diabetic Nephropathy	CTD_human_DG	17607302		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	28240744		★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	BEFREE	31648221		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	31634770		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	18422745		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	18422745, 37081869	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	11912283, 15734764, 27412246		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	15734764		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	27412246	Associate	★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	9241309		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	10363587		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	10363587		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	10363587, 12841873	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	LHGDN	12579281		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	12841873, 16610048	Associate	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	11691808		★☆☆☆☆ Found in Text Mining only
Fibromatosis, Aggressive	Fibromatosis	BEFREE	21826666		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	34171432	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	7559083, 9716029	Associate	★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	9241309		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	10331431, 15986444, 19275511, 23349846, 31811117		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	30894197, 31811117	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	15986444, 19275511, 23349846, 31811117		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	15201962		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	Pubtator	17404502, 30894197	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	CTD_human_DG	21233844		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	BEFREE	25001988, 25428991, 30773478		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	17622248	Associate	★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	20544404		★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	39900120	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	10752993		★☆☆☆☆ Found in Text Mining only
Hypertension Portal	Portal hypertension	Pubtator	36628818	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	20431264, 29876944		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	24500281	Stimulate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	32153561	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	30217121		★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	17379400		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	30062439		★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	17694547		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	27530994, 28011057, 29366580, 31650729, 31740699		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	19409372		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10835519, 12926063, 12966430, 17112419, 17303011, 17317821, 17451201, 17461503, 19399928, 22672821, 25655295, 26414287, 27813495, 28430645, 31403802, 31600291, 31777190, 8383007		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	17451201		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	24500281	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	31034948	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	32153561	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	27903979, 30217121		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	28183532		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24659893	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	29113102	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	20544404		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	10752993		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	10752993		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	15201962		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	CTD_human_DG	21233844		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	20635326, 23962292, 28335760		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	CTD_human_DG	23056237		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15138367, 17653900, 26159850		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	31634770		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	10363587		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	23976985, 8217186		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	11489832, 22249249		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	11781662, 12017272, 18717994, 21632553, 24024905, 24567526		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	16800821, 16832814, 28918838, 30142541, 30993586		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	10934290, 17484808, 19250738, 22576950, 28656262, 9716029		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	14613994, 17919690, 8653688		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10408712, 10969765, 11781662, 15578698, 16832814, 17066487, 17112419, 17171794, 17665317, 17694547, 18350623, 18682710, 18717994, 18806831, 19275511, 20431264, 20511550, 21360556, 22576950, 22672821, 22726064, 23591195, 23976985, 24460734, 25017879, 25492619, 26159850, 26297257, 26656665, 27692729, 27992669, 28686647, 29164967, 30217121, 30993586, 31634770, 31648221, 31801970, 8653688		★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	11244508, 16211240, 20603890		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	12648577, 15368588		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	15050737		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15138367		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	10331431		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	23543055	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	26032414	Inhibit	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	28658220, 28787586		★☆☆☆☆ Found in Text Mining only
Memory Disorders	Memory Disorders	CTD_human_DG	19217924		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Meningioma	Meningioma	BEFREE	17181554		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	17181554	Stimulate	★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	20635326, 28335760		★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	33800494	Associate	★☆☆☆☆ Found in Text Mining only
mixed gliomas	Glioma	CTD_human_DG	21233844		★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	36216310	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	10408712	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	30217121		★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE DISORDER, CHRONIC, WITH EOSINOPHILIA	Myeloproliferative Disorder with Eosinophilia	BEFREE	29797475		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	19060126		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	LHGDN	19060126		★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	30647120		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	30001734		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10752993, 10842189, 10969765, 11048798, 12403556, 12648577, 12771916, 12883697, 14613994, 15734764, 16211240, 16610048, 16800821, 17303011, 17484808, 17695518, 17919690, 19152444, 20511550, 20603890, 20635326, 20811700, 21552147, 21787488, 22099874, 22672821, 22707563, 22726064, 23243020, 23962292, 23976985, 24116381, 25017879, 25428991, 25492619, 25889497, 26059686, 26159850, 26687816, 28102487, 28430645, 28918838, 30548997, 30773478, 8383007, 8653688		★☆☆☆☆ Found in Text Mining only
Neoplasms, Intracranial	Intracranial Neoplasm	BEFREE	17181554		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	10969765, 8383007, 8950987, 9193798		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	31031625		★☆☆☆☆ Found in Text Mining only
Nervous System Neoplasms	Nervous System Neoplasms	BEFREE	11244508		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10969765, 11691808, 12771916, 21989914, 23243020, 24116381, 25492619		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	19016768	Stimulate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	26687816	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	29164967, 31031625		★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumor, Primitive	Neuroectodermal Tumors	BEFREE	10331431		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	27829249		★☆☆☆☆ Found in Text Mining only
neurofibroma	Neurofibroma	BEFREE	10469340, 11244508, 12403556		★☆☆☆☆ Found in Text Mining only
Neurofibromatoses	Neurofibromatosis	BEFREE	10469340, 11244508, 12403556		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	10469340, 11244508		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	Pubtator	10469340	Associate	★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	LHGDN	15355893		★☆☆☆☆ Found in Text Mining only
Nodular glomerulosclerosis	Glomerulosclerosis	CTD_human_DG	17607302		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	22669742, 23224432, 23976985, 26656665, 29797475		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	31634770, 31648221		★☆☆☆☆ Found in Text Mining only
Odontogenic Tumors	Odontogenic Tumor	LHGDN	18329695		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	22099874, 24577130		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	22099874, 25613065	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	11489832, 22249249, 9241309		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	17900261, 22249249	Associate	★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	16800821, 16832814		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	11781662, 12017272, 18717994, 21632553, 24024905, 24567526, 26251031		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	12017272		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	18717994, 24567526, 24659893	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	27992669		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	11048798, 24272599, 26297257, 30200153		★☆☆☆☆ Found in Text Mining only
Periapical Periodontitis	Periapical Periodontitis	BEFREE	21787488		★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	29164967		★☆☆☆☆ Found in Text Mining only
Pituitary Diseases	Pituitary Diseases	BEFREE	28392548		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	17267033		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	17267033, 20544404		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	LHGDN	17267033		★☆☆☆☆ Found in Text Mining only
Primary amyloidosis	Amyloidosis	BEFREE	19409372		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	16800821, 16832814, 28918838, 30142541, 30993586		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	36018546	Associate	★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	31284807		★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor Predisposition Syndrome 1	Rhabdoid tumor predisposition syndrome	Pubtator	26998479	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	15146411, 20431264, 27163292, 27903979, 30217121, 31324694		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	15146411		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	LHGDN	18698021		★☆☆☆☆ Found in Text Mining only
Sarcoma Alveolar Soft Part	Sarcoma	Pubtator	19146682	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	21747397, 29164967		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	21747397		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	GWASCAT_DG	28540026, 30285260		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Septicemia	Septicemia	BEFREE	31284807		★☆☆☆☆ Found in Text Mining only
SHWACHMAN-DIAMOND SYNDROME 1	Shwachman-Diamond Syndrome	BEFREE	15368588		★☆☆☆☆ Found in Text Mining only
Sicca Syndrome	Sjogren`s Syndrome	BEFREE	27903979		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	12841873, 18682710, 18851943		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	18682710, 20811700, 22344722, 29113102		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	16610048, 30778774		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	18682710	Stimulate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	26798989, 29113102, 32671980	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	18851943		★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	30115630		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	17484808, 19250738, 22576950, 28656262		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	15649256, 17484808, 22415659, 22576950, 9310258	Associate	★☆☆☆☆ Found in Text Mining only
Sweet Syndrome	Sweet Syndrome	BEFREE	27903979		★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	27903979		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	Pubtator	9378726	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	11752453, 37733241	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	25411136	Stimulate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	27692729, 30217121		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	23591195	Stimulate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	35503453	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Ventricular remodeling	Pubtator	32701210	Stimulate	★☆☆☆☆ Found in Text Mining only