MDH2 (malate dehydrogenase 2)

Gene

• Entrez ID: 4191
• Gene name: Malate dehydrogenase 2
• Gene symbol: MDH2
• Synonyms (NCBI Gene): DEE51, EIEE51, M-MDH, MDH, MGC:3559, MOR1
• Chromosome: 7
• Chromosome location: 7q11.23
• Summary: Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. The protein encoded by this gene is localized to the mitochondria and may play pivotal roles in the malate-

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs373968974	G>A	Conflicting-interpretations-of-pathogenicity	Missense variant, genic downstream transcript variant, coding sequence variant
rs375002796	C>G,T	Pathogenic	Missense variant, genic downstream transcript variant, coding sequence variant
rs782308462	G>A	Pathogenic	Coding sequence variant, intron variant, missense variant, genic downstream transcript variant
rs1057519566	C>T	Pathogenic	Missense variant, genic downstream transcript variant, coding sequence variant
rs1057519567	G>-	Pathogenic	Genic downstream transcript variant, coding sequence variant, frameshift variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT046682	hsa-miR-222-3p	CLASH	23622248
MIRT046217	hsa-miR-27b-3p	CLASH	23622248
MIRT044824	hsa-miR-320a	CLASH	23622248
MIRT042426	hsa-miR-425-3p	CLASH	23622248
MIRT041647	hsa-miR-484	CLASH	23622248
MIRT041283	hsa-miR-193b-3p	CLASH	23622248
MIRT039952	hsa-miR-615-3p	CLASH	23622248
MIRT035981	hsa-miR-1301-3p	CLASH	23622248
MIRT041283	hsa-miR-193b-3p	PAR-CLIP	27292025
MIRT1138619	hsa-miR-205	CLIP-seq
MIRT1138620	hsa-miR-2276	CLIP-seq
MIRT1138621	hsa-miR-3119	CLIP-seq
MIRT1138622	hsa-miR-3163	CLIP-seq
MIRT1138623	hsa-miR-4668-3p	CLIP-seq
MIRT1138624	hsa-miR-4686	CLIP-seq
MIRT1138625	hsa-miR-4772-3p	CLIP-seq
MIRT1138626	hsa-miR-4787-3p	CLIP-seq
MIRT1138627	hsa-miR-891a	CLIP-seq
MIRT2039330	hsa-miR-101	CLIP-seq
MIRT2039331	hsa-miR-1272	CLIP-seq
MIRT2039332	hsa-miR-144	CLIP-seq
MIRT1138619	hsa-miR-205	CLIP-seq
MIRT2039333	hsa-miR-2964a-5p	CLIP-seq
MIRT2039334	hsa-miR-3202	CLIP-seq
MIRT2039335	hsa-miR-3682-3p	CLIP-seq
MIRT2039336	hsa-miR-3910	CLIP-seq
MIRT2039337	hsa-miR-4533	CLIP-seq
MIRT1138626	hsa-miR-4787-3p	CLIP-seq
MIRT2039330	hsa-miR-101	CLIP-seq
MIRT2039331	hsa-miR-1272	CLIP-seq
MIRT2039332	hsa-miR-144	CLIP-seq
MIRT1138619	hsa-miR-205	CLIP-seq
MIRT1138620	hsa-miR-2276	CLIP-seq
MIRT2039333	hsa-miR-2964a-5p	CLIP-seq
MIRT2039334	hsa-miR-3202	CLIP-seq
MIRT2039335	hsa-miR-3682-3p	CLIP-seq
MIRT2039336	hsa-miR-3910	CLIP-seq
MIRT2039337	hsa-miR-4533	CLIP-seq
MIRT1138624	hsa-miR-4686	CLIP-seq
MIRT1138625	hsa-miR-4772-3p	CLIP-seq
MIRT1138626	hsa-miR-4787-3p	CLIP-seq
MIRT2269413	hsa-miR-520d-5p	CLIP-seq
MIRT2269414	hsa-miR-524-5p	CLIP-seq
MIRT2269415	hsa-miR-561	CLIP-seq
MIRT1138627	hsa-miR-891a	CLIP-seq
MIRT1138626	hsa-miR-4787-3p	CLIP-seq
MIRT2568593	hsa-miR-193b	CLIP-seq
MIRT1138619	hsa-miR-205	CLIP-seq
MIRT2568594	hsa-miR-4701-5p	CLIP-seq
MIRT2568595	hsa-miR-588	CLIP-seq
MIRT2568593	hsa-miR-193b	CLIP-seq
MIRT1138619	hsa-miR-205	CLIP-seq
MIRT2568594	hsa-miR-4701-5p	CLIP-seq
MIRT2568595	hsa-miR-588	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003824	Function	Catalytic activity	IEA
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005737	Component	Cytoplasm	IBA
GO:0005739	Component	Mitochondrion	HDA	20833797
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IDA	16740313
GO:0005739	Component	Mitochondrion	IEA
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0006094	Process	Gluconeogenesis	IEA
GO:0006099	Process	Tricarboxylic acid cycle	IBA
GO:0006099	Process	Tricarboxylic acid cycle	IEA
GO:0006099	Process	Tricarboxylic acid cycle	IMP	37647199
GO:0006099	Process	Tricarboxylic acid cycle	TAS
GO:0006108	Process	Malate metabolic process	IDA	16740313
GO:0006108	Process	Malate metabolic process	IEA
GO:0006108	Process	Malate metabolic process	IMP	6576816
GO:0009060	Process	Aerobic respiration	IDA	27989324
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016615	Function	Malate dehydrogenase activity	IEA
GO:0016616	Function	Oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor	IEA
GO:0019674	Process	NAD+ metabolic process	IEA
GO:0019752	Process	Carboxylic acid metabolic process	IEA
GO:0030060	Function	L-malate dehydrogenase (NAD+) activity	EXP	16740313
GO:0030060	Function	L-malate dehydrogenase (NAD+) activity	IBA
GO:0030060	Function	L-malate dehydrogenase (NAD+) activity	IDA	16740313, 27989324
GO:0030060	Function	L-malate dehydrogenase (NAD+) activity	IEA
GO:0030060	Function	L-malate dehydrogenase (NAD+) activity	IMP	6576816
GO:0042802	Function	Identical protein binding	IEA
GO:0043490	Process	Malate-aspartate shuttle	IEA
GO:0043490	Process	Malate-aspartate shuttle	IMP	37647199
GO:0043490	Process	Malate-aspartate shuttle	TAS
GO:0046554	Function	L-malate dehydrogenase (NADP+) activity	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337, 23533145

Other IDs

• MIM: 154100
• HGNC: 6971
• e!Ensembl: ENSG00000146701

Protein

• UniProt ID: P40926
• Protein name: Malate dehydrogenase, mitochondrial (EC 1.1.1.37)
• PDB: 2DFD, 4WLE, 4WLF, 4WLN, 4WLO, 4WLU, 4WLV
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00056	Ldh_1_N	25 → 168	lactate/malate dehydrogenase, NAD binding domain	Family
  PF02866	Ldh_1_C	170 → 334	lactate/malate dehydrogenase, alpha/beta C-terminal domain	Domain

• Sequence:

  MLSALARPASAALRRSFSTSAQNNAKVAVLGASGGIGQPLSLLLKNSPLVSRLTLYDIAH
  TPGVAADLSHIETKAAVKGYLGPEQLPDCLKGCDVVVIPAGVPRKPGMTRDDLFNTNATI
  VATLTAACAQHCPEAMICVIANPVNSTIPITAEVFKKHGVYNPNKIFGVTTLDIVRANTF
  VAELKGLDPARVNVPVIGGHAGKTIIPLISQCTPKVDFPQDQLTALTGRIQEAGTEVVKA
  KAGAGSATLSMAYAGARFVFSLVDAMNGKEGVVECSFVKSQETECTYFSTPLLLGKKGIE
  KNLGIGKVSSFEEKMISDAIPELKASIKKGEDFVKTLK

• Sequence length: 338

Pathways

KEGG:

Citrate cycle (TCA cycle)
Cysteine and methionine metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism

Reactome:

Gluconeogenesis
Citric acid cycle (TCA cycle)

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Developmental and epileptic encephalopathy, 51	Likely pathogenic; Pathogenic	rs782759642, rs782048786, rs1057519566, rs1057519567, rs782308462	RCV005032132 RCV002468746 RCV000417059 RCV000417042 RCV000417051	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Infantile encephalopathy	Pathogenic	rs1057519566, rs1057519567	RCV000496994 RCV000509017	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Adrenocortical carcinoma, hereditary	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, OVARIAN EPITHELIAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic lymphocytic leukemia/small lymphocytic lymphoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEVELOPMENTAL AND EPILEPTIC ENCEPHALOPATHY 51	—	CTD, Disgenet, HPO CTD, Disgenet, HPO CTD, Disgenet, HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Developmental and epileptic encephalopathy, 1	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPTIC ENCEPHALOPATHY, EARLY INFANTILE, 1	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial pancreatic carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary pheochromocytoma and paraganglioma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MDH2-related disorder	Uncertain significance; Likely benign; Conflicting classifications of pathogenicity; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Papillary renal cell carcinoma type 1	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	25766404, 26839173, 27989324, 28332880, 30008476		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	28332880		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	26059363	Associate	★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	CTD_human_DG	12376462		★☆☆☆☆ Found in Text Mining only
Aniridia	Aniridia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	27989324	Associate	★☆☆☆☆ Found in Text Mining only
Bronchioloalveolar Adenocarcinoma	Lung adenocarcinoma	BEFREE	22343475		★☆☆☆☆ Found in Text Mining only
Capillary hemangioma of retina	Capillary Hemangioma Of Retina	HPO_DG			★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	CTD_human_DG	12376462		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	CTD_human_DG	28811376		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma, Spindle-Cell	Carcinoma	CTD_human_DG	12376462		★☆☆☆☆ Found in Text Mining only
Cerebellar atrophy	Cerebellar atrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Chronic Pain	Chronic pain	Pubtator	27832094	Associate	★☆☆☆☆ Found in Text Mining only
Conductive hearing loss	Hearing Loss	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital adrenal hyperplasia	Congenital adrenal hyperplasia	BEFREE	28332880		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	HPO_DG			★☆☆☆☆ Found in Text Mining only
Conn Adenoma	Conn Adenoma	BEFREE	28332880		★☆☆☆☆ Found in Text Mining only
Cranial nerve compression	Cranial nerve compression	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	35954202	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	27611087		★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	37977948	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	31308875		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	36187097	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	28189066		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	36079864, 37977948	Associate	★☆☆☆☆ Found in Text Mining only
Epileptic encephalopathy	Epileptic encephalopathy	HPO_DG			★☆☆☆☆ Found in Text Mining only
EPILEPTIC ENCEPHALOPATHY, EARLY INFANTILE, 51	Epileptic encephalopathy	UNIPROT_DG	27989324		★☆☆☆☆ Found in Text Mining only
EPILEPTIC ENCEPHALOPATHY, EARLY INFANTILE, 51	Epileptic encephalopathy	GENOMICS_ENGLAND_DG	27989324		★☆☆☆☆ Found in Text Mining only
EPILEPTIC ENCEPHALOPATHY, EARLY INFANTILE, 51	Epileptic encephalopathy	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
EPILEPTIC ENCEPHALOPATHY, EARLY INFANTILE, 51	Epileptic encephalopathy	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Episodic paroxysmal anxiety	Episodic paroxysmal anxiety	HPO_DG			★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	18436193		★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	CLINVAR_DG	27989324		★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	31538237		★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis Focal Segmental	Focal segmental glomerulosclerosis	Pubtator	36159820	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Paraganglioma-Pheochromocytoma Syndrome	Hereditary Paraganglioma-Pheochromocytoma Syndromes	CLINGEN_DG	25766404		★☆☆☆☆ Found in Text Mining only
Hereditary pheochromocytoma-paraganglioma	Hereditary Pheochromocytoma-Paraganglioma	Orphanet			★☆☆☆☆ Found in Text Mining only
Hypercalcemia	Hypercalcemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypertensive Retinopathy	Hypertensive Retinopathy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypoplasia of corpus callosum	Hypoplasia Of Corpus Callosum	HPO_DG			★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	29691148		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	28189066		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	23389923, 30663084		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26138106, 28189066, 28991459		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	6578373		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	BEFREE	27611087		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	36159820	Associate	★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	Pubtator	37977948	Associate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	11959456	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	28619102		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25766404, 8917541		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28819410		★☆☆☆☆ Found in Text Mining only
Panic Attacks	Panic Disorder	HPO_DG			★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	BEFREE	25766404, 27989324, 28332880, 30008476		★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
Paraganglioma of head and neck	Paraganglioma of head and neck	HPO_DG			★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	36593912	Associate	★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	25766404, 27989324, 28332880, 30008476		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	Pubtator	27989324, 30008476	Associate	★☆☆☆☆ Found in Text Mining only
Pheochromocytoma, Extra-Adrenal	Extra-Adrenal Pheochromocytoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	34480296	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	23389923, 30663084		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	23389923	Associate	★☆☆☆☆ Found in Text Mining only
Psychomotor Disorders	Psychiatric disorders	Pubtator	27989324	Associate	★☆☆☆☆ Found in Text Mining only
Pulsatile Tinnitus	Pulsatile Tinnitus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Sinus Tachycardia	Sinus Tachycardia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Strabismus	Strabismus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	CTD_human_DG	12376462		★☆☆☆☆ Found in Text Mining only
Uterine Cancer	Endometrial Cancer	BEFREE	25639359		★☆☆☆☆ Found in Text Mining only
Uterine Neoplasms	Uterine neoplasm	Pubtator	25639359	Associate	★☆☆☆☆ Found in Text Mining only
Vocal Cord Paralysis	Vocal Cord Paralysis	HPO_DG			★☆☆☆☆ Found in Text Mining only