ART3 (ADP-ribosyltransferase 3 (inactive))

Gene

• Entrez ID: 419
• Gene name: ADP-ribosyltransferase 3 (inactive)
• Gene symbol: ART3
• Synonyms (NCBI Gene): ARTC3
• Chromosome: 4
• Chromosome location: 4q21.1|4p15.1-p14
• Summary: This gene encodes an arginine-specific ADP-ribosyltransferase. The encoded protein catalyzes a reversible reaction which modifies proteins by the addition or removal of ADP-ribose to an arginine residue to regulate the function of the modified protein. An

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018426	hsa-miR-335-5p	Microarray	18185580
MIRT023366	hsa-miR-122-5p	Microarray	17612493
MIRT801452	hsa-miR-3646	CLIP-seq
MIRT801453	hsa-miR-3662	CLIP-seq
MIRT801454	hsa-miR-4427	CLIP-seq
MIRT801455	hsa-miR-450b-5p	CLIP-seq
MIRT801456	hsa-miR-4680-3p	CLIP-seq
MIRT801457	hsa-miR-4698	CLIP-seq
MIRT801458	hsa-miR-4762-3p	CLIP-seq
MIRT801459	hsa-miR-518a-5p	CLIP-seq
MIRT801460	hsa-miR-527	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003950	Function	NAD+ poly-ADP-ribosyltransferase activity	IBA
GO:0005576	Component	Extracellular region	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0016020	Component	Membrane	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA
GO:0016779	Function	Nucleotidyltransferase activity	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0098552	Component	Side of membrane	IEA
GO:0106274	Function	NAD+-protein-arginine ADP-ribosyltransferase activity	IEA

Other IDs

• MIM: 603086
• HGNC: 725
• e!Ensembl: ENSG00000156219

Protein

• UniProt ID: Q13508
• Protein name: Ecto-ADP-ribosyltransferase 3 (EC 2.4.2.31) (ADP-ribosyltransferase C2 and C3 toxin-like 3) (ARTC3) (Mono(ADP-ribosyl)transferase 3) (NAD(P)(+)--arginine ADP-ribosyltransferase 3)
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01129	ART	29 → 252	NAD:arginine ADP-ribosyltransferase	Family

• Tissue specificity: TISSUE SPECIFICITY: Testis specific.
• Sequence:

  MKTGHFEIVTMLLATMILVDIFQVKAEVLDMADNAFDDEYLKCTDRMEIKYVPQLLKEEK
  ASHQQLDTVWENAKAKWAARKTQIFLPMNFKDNHGIALMAYISEAQEQTPFYHLFSEAVK
  MAGQSREDYIYGFQFKAFHFYLTRALQLLRKPCEASSKTVVYRTSQGTSFTFGGLNQARF
  GHFTLAYSAKPQAANDQLTVLSIYTCLGVDIENFLDKESERITLIPLNEVFQVSQEGAGN
  NLILQSINKTCSHYECAFLGGLKTENCIENLEYFQPIYVYNPGEKNQKLEDHSEKNWKLE
  DHGEKNQKLEDHGVKILEPTQIPGMKIPEPFPLPEDKSQGNINNPTPGPVPVPGPKSHPS
  ASSGKLLLPQFGMVIILISVSAINLFVAL

• Sequence length: 389

Pathways

Reactome:

Post-translational modification: synthesis of GPI-anchored proteins

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Azoospermia	Azoospermia	BEFREE	18266473		★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	Pubtator	18266473	Associate	★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	37083768	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	29725430		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	20419844		★☆☆☆☆ Found in Text Mining only
Non-obstructive azoospermia	Non-obstructive azoospermia	BEFREE	18266473		★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	30726804		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	25975270		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	31974598	Associate	★☆☆☆☆ Found in Text Mining only