Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	4185
Gene name	ADAM metallopeptidase domain 11
Gene symbol	ADAM11
Synonyms (NCBI Gene)	MDC
Chromosome	17
Chromosome location	17q21.31
Summary	This gene encodes a member of the ADAM (a disintegrin and metalloprotease) protein family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processe

Show/Hide all (57)

miRTarBase ID	miRNA	Experiments
MIRT765889	hsa-miR-1470	CLIP-seq
MIRT765890	hsa-miR-19a	CLIP-seq
MIRT765891	hsa-miR-19b	CLIP-seq
MIRT765892	hsa-miR-3173-3p	CLIP-seq
MIRT765893	hsa-miR-3184	CLIP-seq
MIRT765894	hsa-miR-34a	CLIP-seq
MIRT765895	hsa-miR-34c-5p	CLIP-seq
MIRT765896	hsa-miR-3617	CLIP-seq
MIRT765897	hsa-miR-423-5p	CLIP-seq
MIRT765898	hsa-miR-4455	CLIP-seq
MIRT765899	hsa-miR-4469	CLIP-seq
MIRT765900	hsa-miR-449a	CLIP-seq
MIRT765901	hsa-miR-449b	CLIP-seq
MIRT765902	hsa-miR-4529-5p	CLIP-seq
MIRT765903	hsa-miR-4645-5p	CLIP-seq
MIRT765904	hsa-miR-4667-3p	CLIP-seq
MIRT765905	hsa-miR-4673	CLIP-seq
MIRT765906	hsa-miR-4684-3p	CLIP-seq
MIRT765907	hsa-miR-4708-3p	CLIP-seq
MIRT765908	hsa-miR-4779	CLIP-seq
MIRT765909	hsa-miR-486-3p	CLIP-seq
MIRT765910	hsa-miR-602	CLIP-seq
MIRT765911	hsa-miR-609	CLIP-seq
MIRT765912	hsa-miR-641	CLIP-seq
MIRT1925677	hsa-miR-1827	CLIP-seq
MIRT1925678	hsa-miR-3622a-5p	CLIP-seq
MIRT1925679	hsa-miR-4292	CLIP-seq
MIRT1925680	hsa-miR-4308	CLIP-seq
MIRT1925681	hsa-miR-4423-3p	CLIP-seq
MIRT765903	hsa-miR-4645-5p	CLIP-seq
MIRT765905	hsa-miR-4673	CLIP-seq
MIRT1925682	hsa-miR-4685-5p	CLIP-seq
MIRT1925683	hsa-miR-4727-5p	CLIP-seq
MIRT1925684	hsa-miR-4755-3p	CLIP-seq
MIRT1925685	hsa-miR-4769-3p	CLIP-seq
MIRT1925686	hsa-miR-483-3p	CLIP-seq
MIRT2167085	hsa-miR-1202	CLIP-seq
MIRT2167086	hsa-miR-1207-3p	CLIP-seq
MIRT2167087	hsa-miR-147	CLIP-seq
MIRT2167088	hsa-miR-3135b	CLIP-seq
MIRT2167089	hsa-miR-3194-5p	CLIP-seq
MIRT2167090	hsa-miR-3670	CLIP-seq
MIRT2167091	hsa-miR-3911	CLIP-seq
MIRT2167092	hsa-miR-3972	CLIP-seq
MIRT2167093	hsa-miR-4302	CLIP-seq
MIRT2167094	hsa-miR-4633-3p	CLIP-seq
MIRT2167095	hsa-miR-644	CLIP-seq
MIRT2383877	hsa-miR-1291	CLIP-seq
MIRT2383878	hsa-miR-3173-5p	CLIP-seq
MIRT2383879	hsa-miR-328	CLIP-seq
MIRT2383880	hsa-miR-4268	CLIP-seq
MIRT2383881	hsa-miR-4286	CLIP-seq
MIRT2383882	hsa-miR-4448	CLIP-seq
MIRT2443120	hsa-miR-361-3p	CLIP-seq
MIRT2383881	hsa-miR-4286	CLIP-seq
MIRT2443121	hsa-miR-4690-3p	CLIP-seq
MIRT2443122	hsa-miR-4726-3p	CLIP-seq

Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004222	Function	Metalloendopeptidase activity	IBA
GO:0004222	Function	Metalloendopeptidase activity	IEA
GO:0005178	Function	Integrin binding	TAS	9693107
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9693107
GO:0006508	Process	Proteolysis	IBA
GO:0006508	Process	Proteolysis	IEA
GO:0007229	Process	Integrin-mediated signaling pathway	TAS	8252040
GO:0008237	Function	Metallopeptidase activity	IEA
GO:0008237	Function	Metallopeptidase activity	TAS	9693107
GO:0016020	Component	Membrane	IEA
GO:0030424	Component	Axon	IEA
GO:0031012	Component	Extracellular matrix	ISS	22261194
GO:0033555	Process	Multicellular organismal response to stress	ISS
GO:0042734	Component	Presynaptic membrane	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043204	Component	Perikaryon	IEA
GO:0045184	Process	Establishment of protein localization	ISS
GO:0045202	Component	Synapse	IEA
GO:0061367	Process	Behavioral response to acetic acid induced pain	ISS
GO:0061368	Process	Behavioral response to formalin induced pain	ISS

MIM	HGNC	e!Ensembl
155120	189	ENSG00000073670

O75078

Protein name

Disintegrin and metalloproteinase domain-containing protein 11 (ADAM 11) (Metalloproteinase-like, disintegrin-like, and cysteine-rich protein) (MDC)

Protein function

Probable ligand for integrin in the brain. This is a non catalytic metalloprotease-like protein. Required for localization of the potassium channel subunit proteins KCNA1/KV1.1 and KCNA2/KV1.2 at cerebellar cortex basket cell distal terminals, i

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01562	Pep_M12B_propep	46 → 189	Reprolysin family propeptide	Family
PF01421	Reprolysin	239 → 438	Reprolysin (M12B) family zinc metalloprotease	Domain
PF00200	Disintegrin	453 → 526	Disintegrin	Domain
PF08516	ADAM_CR	531 → 647	ADAM cysteine-rich	Family
PF07974	EGF_2	677 → 709	EGF-like domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed predominantly in brain. Slightly detected or not at all in other tissues.

Sequence

MRLLRRWAFAALLLSLLPTPGLGTQGPAGALRWGGLPQLGGPGAPEVTEPSRLVRESSGG
EVRKQQLDTRVRQEPPGGPPVHLAQVSFVIPAFNSNFTLDLELNHHLLSSQYVERHFSRE
GTTQHSTGAGDHCYYQGKLRGNPHSFAALSTCQGLHGVFSDGNLTYIVEPQEVAGPWGAP
QGPLPHLIYRTPLLPDPLGCREPGCLFAVPAQSAPPNRPRLRRKRQVRRGHPTVHSETKY
VELIVINDHQLFEQMRQSVVLTSNFAKSVVNLADVIYKEQLNTRIVLVAMETWADGDKIQ
VQDDLLETLARLMVYRREGLPEPSDATHLFSGRTFQSTSSGAAYVGGICSLSHGGGVNEY
GNMGAMAVTLAQTLGQNLGMMWNKHRSSAGDCKCPDIWLGCIMEDTGFYLPRKFSRCSID
EYNQFLQEGGGSCLFNKPLKLLDPPECGNGFVEAGEECDCGSVQECSRAGGNCCKKCTLT
HDAMCSDGLCCRRCKYEPRGVSCREAVNECDIAETCTGDSSQCPPNLHKLDGYYCDHEQG
RCYGGRCKTRDRQCQVLWGHAAADRFCYEKLNVEGTERGSCGRKGSGWVQCSKQDVLCGF
LLCVNISGAPRLGDLVGDISSVTFYHQGKELDCRGGHVQLADGSDLSYVEDGTACGPNML
CLDHRCLPASAFNFSTCPGSGERRICSHHGVCSNEGKCICQPDWTGKDCSIHNPLPTSPP
TGETERYKGPSGTNIIIGSIAGAVLVAAIVLGGTGWGFKNIRRGRSGGA

Sequence length

769

Interactions

View interactions

	Reactome
			LGI-ADAM interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (26)

Disease Name	Disease (Merged)	Source	PMID	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	11861261	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	19942450	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	22293394	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	25660220	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	23967253	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	25682028	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	24704449, 28958612	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	27218257	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	27218257	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	31533499	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	24704449, 28958612	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	18275430	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	21550219	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	11861261	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	22293394	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	25660220	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21550219, 25391539, 27218257	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	27218257	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30994173, 9199213	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	26865658	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis of hip	Osteoarthritis Of Hip	BEFREE	29402254	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	UNIPROT_DG		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	29580878	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	19942450	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	27650194	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	28859361, 29156846	★★★★★ ★☆☆☆☆ Found in Text Mining only

ADAM11 (ADAM metallopeptidase domain 11)