MCM7 (minichromosome maintenance complex component 7)

Gene

• Entrez ID: 4176
• Gene name: Minichromosome maintenance complex component 7
• Gene symbol: MCM7
• Synonyms (NCBI Gene): CDC47, MCM2, P1.1-MCM3, P1CDC47, P85MCM, PNAS146, PPP1R104
• Chromosome: 7
• Chromosome location: 7q22.1
• Summary: The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT016521	hsa-miR-193b-3p	Proteomics	21512034
MIRT016521	hsa-miR-193b-3p	Microarray	20304954
MIRT022853	hsa-miR-124-3p	Proteomics;Microarray	18668037
MIRT023890	hsa-miR-1-3p	Proteomics	18668040
MIRT025469	hsa-miR-34a-5p	Proteomics	21566225
MIRT025469	hsa-miR-34a-5p	Proteomics	21566225
MIRT052320	hsa-let-7b-5p	CLASH	23622248
MIRT049815	hsa-miR-92a-3p	CLASH	23622248
MIRT048095	hsa-miR-197-3p	CLASH	23622248
MIRT046710	hsa-miR-222-3p	CLASH	23622248
MIRT042002	hsa-miR-484	CLASH	23622248
MIRT041105	hsa-miR-503-5p	CLASH	23622248
MIRT038750	hsa-miR-93-3p	CLASH	23622248
MIRT035789	hsa-miR-1914-5p	CLASH	23622248
MIRT052674	hsa-miR-1260b	CLASH	23622248
MIRT509436	hsa-miR-583	PAR-CLIP	20371350
MIRT509435	hsa-miR-519a-3p	PAR-CLIP	20371350
MIRT509434	hsa-miR-519b-3p	PAR-CLIP	20371350
MIRT509433	hsa-miR-519c-3p	PAR-CLIP	20371350
MIRT509432	hsa-miR-302a-3p	PAR-CLIP	20371350
MIRT509431	hsa-miR-302b-3p	PAR-CLIP	20371350
MIRT509430	hsa-miR-302c-3p	PAR-CLIP	20371350
MIRT509429	hsa-miR-302d-3p	PAR-CLIP	20371350
MIRT509428	hsa-miR-302e	PAR-CLIP	20371350
MIRT509427	hsa-miR-372-3p	PAR-CLIP	20371350
MIRT509426	hsa-miR-373-3p	PAR-CLIP	20371350
MIRT509425	hsa-miR-520a-3p	PAR-CLIP	20371350
MIRT509424	hsa-miR-520b	PAR-CLIP	20371350
MIRT509423	hsa-miR-520c-3p	PAR-CLIP	20371350
MIRT509422	hsa-miR-520d-3p	PAR-CLIP	20371350
MIRT509421	hsa-miR-520e	PAR-CLIP	20371350
MIRT509420	hsa-miR-548p	PAR-CLIP	20371350
MIRT509419	hsa-miR-6085	PAR-CLIP	20371350
MIRT509418	hsa-miR-6813-5p	PAR-CLIP	20371350
MIRT509417	hsa-miR-6871-5p	PAR-CLIP	20371350
MIRT509416	hsa-miR-3184-5p	PAR-CLIP	20371350
MIRT509415	hsa-miR-423-5p	PAR-CLIP	20371350
MIRT509414	hsa-miR-548aj-5p	PAR-CLIP	20371350
MIRT509413	hsa-miR-548f-5p	PAR-CLIP	20371350
MIRT509412	hsa-miR-548g-5p	PAR-CLIP	20371350
MIRT509411	hsa-miR-548x-5p	PAR-CLIP	20371350
MIRT509410	hsa-miR-103a-3p	PAR-CLIP	20371350
MIRT509409	hsa-miR-107	PAR-CLIP	20371350
MIRT509408	hsa-miR-4268	PAR-CLIP	20371350
MIRT509407	hsa-miR-6878-5p	PAR-CLIP	20371350
MIRT509406	hsa-miR-6731-5p	PAR-CLIP	20371350
MIRT509405	hsa-miR-8085	PAR-CLIP	20371350
MIRT509404	hsa-miR-4283	PAR-CLIP	20371350
MIRT509403	hsa-miR-3944-5p	PAR-CLIP	20371350
MIRT509401	hsa-miR-30c-1-3p	PAR-CLIP	20371350
MIRT509400	hsa-miR-30c-2-3p	PAR-CLIP	20371350
MIRT509399	hsa-miR-6788-5p	PAR-CLIP	20371350
MIRT509436	hsa-miR-583	PAR-CLIP	20371350
MIRT509435	hsa-miR-519a-3p	PAR-CLIP	20371350
MIRT509434	hsa-miR-519b-3p	PAR-CLIP	20371350
MIRT509433	hsa-miR-519c-3p	PAR-CLIP	20371350
MIRT509432	hsa-miR-302a-3p	PAR-CLIP	20371350
MIRT509431	hsa-miR-302b-3p	PAR-CLIP	20371350
MIRT509430	hsa-miR-302c-3p	PAR-CLIP	20371350
MIRT509429	hsa-miR-302d-3p	PAR-CLIP	20371350
MIRT509428	hsa-miR-302e	PAR-CLIP	20371350
MIRT509427	hsa-miR-372-3p	PAR-CLIP	20371350
MIRT509426	hsa-miR-373-3p	PAR-CLIP	20371350
MIRT509425	hsa-miR-520a-3p	PAR-CLIP	20371350
MIRT509424	hsa-miR-520b	PAR-CLIP	20371350
MIRT509423	hsa-miR-520c-3p	PAR-CLIP	20371350
MIRT509422	hsa-miR-520d-3p	PAR-CLIP	20371350
MIRT509421	hsa-miR-520e	PAR-CLIP	20371350
MIRT509420	hsa-miR-548p	PAR-CLIP	20371350
MIRT509419	hsa-miR-6085	PAR-CLIP	20371350
MIRT509418	hsa-miR-6813-5p	PAR-CLIP	20371350
MIRT509417	hsa-miR-6871-5p	PAR-CLIP	20371350
MIRT509416	hsa-miR-3184-5p	PAR-CLIP	20371350
MIRT509415	hsa-miR-423-5p	PAR-CLIP	20371350
MIRT509414	hsa-miR-548aj-5p	PAR-CLIP	20371350
MIRT509413	hsa-miR-548f-5p	PAR-CLIP	20371350
MIRT509412	hsa-miR-548g-5p	PAR-CLIP	20371350
MIRT509411	hsa-miR-548x-5p	PAR-CLIP	20371350
MIRT509410	hsa-miR-103a-3p	PAR-CLIP	20371350
MIRT509409	hsa-miR-107	PAR-CLIP	20371350
MIRT509408	hsa-miR-4268	PAR-CLIP	20371350
MIRT509407	hsa-miR-6878-5p	PAR-CLIP	20371350
MIRT509406	hsa-miR-6731-5p	PAR-CLIP	20371350
MIRT509405	hsa-miR-8085	PAR-CLIP	20371350
MIRT509404	hsa-miR-4283	PAR-CLIP	20371350
MIRT509403	hsa-miR-3944-5p	PAR-CLIP	20371350
MIRT509402	hsa-miR-4766-3p	PAR-CLIP	20371350
MIRT509401	hsa-miR-30c-1-3p	PAR-CLIP	20371350
MIRT509400	hsa-miR-30c-2-3p	PAR-CLIP	20371350
MIRT509399	hsa-miR-6788-5p	PAR-CLIP	20371350
MIRT509436	hsa-miR-583	PAR-CLIP	21572407
MIRT509435	hsa-miR-519a-3p	PAR-CLIP	21572407
MIRT509434	hsa-miR-519b-3p	PAR-CLIP	21572407
MIRT509433	hsa-miR-519c-3p	PAR-CLIP	21572407
MIRT509432	hsa-miR-302a-3p	PAR-CLIP	21572407
MIRT509431	hsa-miR-302b-3p	PAR-CLIP	21572407
MIRT509430	hsa-miR-302c-3p	PAR-CLIP	21572407
MIRT509429	hsa-miR-302d-3p	PAR-CLIP	21572407
MIRT509428	hsa-miR-302e	PAR-CLIP	21572407
MIRT509427	hsa-miR-372-3p	PAR-CLIP	21572407
MIRT509426	hsa-miR-373-3p	PAR-CLIP	21572407
MIRT509425	hsa-miR-520a-3p	PAR-CLIP	21572407
MIRT509424	hsa-miR-520b	PAR-CLIP	21572407
MIRT509423	hsa-miR-520c-3p	PAR-CLIP	21572407
MIRT509422	hsa-miR-520d-3p	PAR-CLIP	21572407
MIRT509421	hsa-miR-520e	PAR-CLIP	21572407
MIRT509420	hsa-miR-548p	PAR-CLIP	21572407
MIRT509419	hsa-miR-6085	PAR-CLIP	21572407
MIRT509418	hsa-miR-6813-5p	PAR-CLIP	21572407
MIRT509417	hsa-miR-6871-5p	PAR-CLIP	21572407
MIRT509416	hsa-miR-3184-5p	PAR-CLIP	21572407
MIRT509415	hsa-miR-423-5p	PAR-CLIP	21572407
MIRT509414	hsa-miR-548aj-5p	PAR-CLIP	21572407
MIRT509413	hsa-miR-548f-5p	PAR-CLIP	21572407
MIRT509412	hsa-miR-548g-5p	PAR-CLIP	21572407
MIRT509411	hsa-miR-548x-5p	PAR-CLIP	21572407
MIRT509410	hsa-miR-103a-3p	PAR-CLIP	21572407
MIRT509409	hsa-miR-107	PAR-CLIP	21572407
MIRT509408	hsa-miR-4268	PAR-CLIP	21572407
MIRT509407	hsa-miR-6878-5p	PAR-CLIP	21572407
MIRT509406	hsa-miR-6731-5p	PAR-CLIP	21572407
MIRT509405	hsa-miR-8085	PAR-CLIP	21572407
MIRT509404	hsa-miR-4283	PAR-CLIP	21572407
MIRT509403	hsa-miR-3944-5p	PAR-CLIP	21572407
MIRT509402	hsa-miR-4766-3p	PAR-CLIP	21572407
MIRT509401	hsa-miR-30c-1-3p	PAR-CLIP	21572407
MIRT509400	hsa-miR-30c-2-3p	PAR-CLIP	21572407
MIRT509399	hsa-miR-6788-5p	PAR-CLIP	21572407
MIRT509436	hsa-miR-583	PAR-CLIP	23446348
MIRT509435	hsa-miR-519a-3p	PAR-CLIP	23446348
MIRT509434	hsa-miR-519b-3p	PAR-CLIP	23446348
MIRT509433	hsa-miR-519c-3p	PAR-CLIP	23446348
MIRT509432	hsa-miR-302a-3p	PAR-CLIP	23446348
MIRT509431	hsa-miR-302b-3p	PAR-CLIP	23446348
MIRT509430	hsa-miR-302c-3p	PAR-CLIP	23446348
MIRT509429	hsa-miR-302d-3p	PAR-CLIP	23446348
MIRT509428	hsa-miR-302e	PAR-CLIP	23446348
MIRT509427	hsa-miR-372-3p	PAR-CLIP	23446348
MIRT509426	hsa-miR-373-3p	PAR-CLIP	23446348
MIRT509425	hsa-miR-520a-3p	PAR-CLIP	23446348
MIRT509424	hsa-miR-520b	PAR-CLIP	23446348
MIRT509423	hsa-miR-520c-3p	PAR-CLIP	23446348
MIRT509422	hsa-miR-520d-3p	PAR-CLIP	23446348
MIRT509421	hsa-miR-520e	PAR-CLIP	23446348
MIRT509420	hsa-miR-548p	PAR-CLIP	23446348
MIRT509419	hsa-miR-6085	PAR-CLIP	23446348
MIRT509418	hsa-miR-6813-5p	PAR-CLIP	23446348
MIRT509417	hsa-miR-6871-5p	PAR-CLIP	23446348
MIRT509416	hsa-miR-3184-5p	PAR-CLIP	23446348
MIRT509415	hsa-miR-423-5p	PAR-CLIP	23446348
MIRT509414	hsa-miR-548aj-5p	PAR-CLIP	23446348
MIRT509413	hsa-miR-548f-5p	PAR-CLIP	23446348
MIRT509412	hsa-miR-548g-5p	PAR-CLIP	23446348
MIRT509411	hsa-miR-548x-5p	PAR-CLIP	23446348
MIRT509410	hsa-miR-103a-3p	PAR-CLIP	23446348
MIRT509409	hsa-miR-107	PAR-CLIP	23446348
MIRT509408	hsa-miR-4268	PAR-CLIP	23446348
MIRT509407	hsa-miR-6878-5p	PAR-CLIP	23446348
MIRT509406	hsa-miR-6731-5p	PAR-CLIP	23446348
MIRT509405	hsa-miR-8085	PAR-CLIP	23446348
MIRT509404	hsa-miR-4283	PAR-CLIP	23446348
MIRT509403	hsa-miR-3944-5p	PAR-CLIP	23446348
MIRT509402	hsa-miR-4766-3p	PAR-CLIP	23446348
MIRT509401	hsa-miR-30c-1-3p	PAR-CLIP	23446348
MIRT509400	hsa-miR-30c-2-3p	PAR-CLIP	23446348
MIRT509399	hsa-miR-6788-5p	PAR-CLIP	23446348
MIRT509436	hsa-miR-583	PAR-CLIP	20371350
MIRT509435	hsa-miR-519a-3p	PAR-CLIP	20371350
MIRT509434	hsa-miR-519b-3p	PAR-CLIP	20371350
MIRT509433	hsa-miR-519c-3p	PAR-CLIP	20371350
MIRT509432	hsa-miR-302a-3p	PAR-CLIP	20371350
MIRT509431	hsa-miR-302b-3p	PAR-CLIP	20371350
MIRT509430	hsa-miR-302c-3p	PAR-CLIP	20371350
MIRT509429	hsa-miR-302d-3p	PAR-CLIP	20371350
MIRT509428	hsa-miR-302e	PAR-CLIP	20371350
MIRT509427	hsa-miR-372-3p	PAR-CLIP	20371350
MIRT509426	hsa-miR-373-3p	PAR-CLIP	20371350
MIRT509425	hsa-miR-520a-3p	PAR-CLIP	20371350
MIRT509424	hsa-miR-520b	PAR-CLIP	20371350
MIRT509423	hsa-miR-520c-3p	PAR-CLIP	20371350
MIRT509422	hsa-miR-520d-3p	PAR-CLIP	20371350
MIRT509421	hsa-miR-520e	PAR-CLIP	20371350
MIRT509420	hsa-miR-548p	PAR-CLIP	20371350
MIRT509419	hsa-miR-6085	PAR-CLIP	20371350
MIRT509418	hsa-miR-6813-5p	PAR-CLIP	20371350
MIRT509417	hsa-miR-6871-5p	PAR-CLIP	20371350
MIRT509416	hsa-miR-3184-5p	PAR-CLIP	20371350
MIRT509415	hsa-miR-423-5p	PAR-CLIP	20371350
MIRT509414	hsa-miR-548aj-5p	PAR-CLIP	20371350
MIRT509413	hsa-miR-548f-5p	PAR-CLIP	20371350
MIRT509412	hsa-miR-548g-5p	PAR-CLIP	20371350
MIRT509411	hsa-miR-548x-5p	PAR-CLIP	20371350
MIRT509410	hsa-miR-103a-3p	PAR-CLIP	20371350
MIRT509409	hsa-miR-107	PAR-CLIP	20371350
MIRT509408	hsa-miR-4268	PAR-CLIP	20371350
MIRT509407	hsa-miR-6878-5p	PAR-CLIP	20371350
MIRT509406	hsa-miR-6731-5p	PAR-CLIP	20371350
MIRT509405	hsa-miR-8085	PAR-CLIP	20371350
MIRT509404	hsa-miR-4283	PAR-CLIP	20371350
MIRT509403	hsa-miR-3944-5p	PAR-CLIP	20371350
MIRT509401	hsa-miR-30c-1-3p	PAR-CLIP	20371350
MIRT509400	hsa-miR-30c-2-3p	PAR-CLIP	20371350
MIRT509399	hsa-miR-6788-5p	PAR-CLIP	20371350
MIRT509436	hsa-miR-583	PAR-CLIP	20371350
MIRT509435	hsa-miR-519a-3p	PAR-CLIP	20371350
MIRT509434	hsa-miR-519b-3p	PAR-CLIP	20371350
MIRT509433	hsa-miR-519c-3p	PAR-CLIP	20371350
MIRT509432	hsa-miR-302a-3p	PAR-CLIP	20371350
MIRT509431	hsa-miR-302b-3p	PAR-CLIP	20371350
MIRT509430	hsa-miR-302c-3p	PAR-CLIP	20371350
MIRT509429	hsa-miR-302d-3p	PAR-CLIP	20371350
MIRT509428	hsa-miR-302e	PAR-CLIP	20371350
MIRT509427	hsa-miR-372-3p	PAR-CLIP	20371350
MIRT509426	hsa-miR-373-3p	PAR-CLIP	20371350
MIRT509425	hsa-miR-520a-3p	PAR-CLIP	20371350
MIRT509424	hsa-miR-520b	PAR-CLIP	20371350
MIRT509423	hsa-miR-520c-3p	PAR-CLIP	20371350
MIRT509422	hsa-miR-520d-3p	PAR-CLIP	20371350
MIRT509421	hsa-miR-520e	PAR-CLIP	20371350
MIRT509420	hsa-miR-548p	PAR-CLIP	20371350
MIRT509419	hsa-miR-6085	PAR-CLIP	20371350
MIRT509418	hsa-miR-6813-5p	PAR-CLIP	20371350
MIRT509417	hsa-miR-6871-5p	PAR-CLIP	20371350
MIRT509416	hsa-miR-3184-5p	PAR-CLIP	20371350
MIRT509415	hsa-miR-423-5p	PAR-CLIP	20371350
MIRT509414	hsa-miR-548aj-5p	PAR-CLIP	20371350
MIRT509413	hsa-miR-548f-5p	PAR-CLIP	20371350
MIRT509412	hsa-miR-548g-5p	PAR-CLIP	20371350
MIRT509411	hsa-miR-548x-5p	PAR-CLIP	20371350
MIRT509410	hsa-miR-103a-3p	PAR-CLIP	20371350
MIRT509409	hsa-miR-107	PAR-CLIP	20371350
MIRT509408	hsa-miR-4268	PAR-CLIP	20371350
MIRT509407	hsa-miR-6878-5p	PAR-CLIP	20371350
MIRT509406	hsa-miR-6731-5p	PAR-CLIP	20371350
MIRT509405	hsa-miR-8085	PAR-CLIP	20371350
MIRT509404	hsa-miR-4283	PAR-CLIP	20371350
MIRT509403	hsa-miR-3944-5p	PAR-CLIP	20371350
MIRT509402	hsa-miR-4766-3p	PAR-CLIP	20371350
MIRT509401	hsa-miR-30c-1-3p	PAR-CLIP	20371350
MIRT509400	hsa-miR-30c-2-3p	PAR-CLIP	20371350
MIRT509399	hsa-miR-6788-5p	PAR-CLIP	20371350
MIRT509436	hsa-miR-583	PAR-CLIP	21572407
MIRT509435	hsa-miR-519a-3p	PAR-CLIP	21572407
MIRT509434	hsa-miR-519b-3p	PAR-CLIP	21572407
MIRT509433	hsa-miR-519c-3p	PAR-CLIP	21572407
MIRT509432	hsa-miR-302a-3p	PAR-CLIP	21572407
MIRT509431	hsa-miR-302b-3p	PAR-CLIP	21572407
MIRT509430	hsa-miR-302c-3p	PAR-CLIP	21572407
MIRT509429	hsa-miR-302d-3p	PAR-CLIP	21572407
MIRT509428	hsa-miR-302e	PAR-CLIP	21572407
MIRT509427	hsa-miR-372-3p	PAR-CLIP	21572407
MIRT509426	hsa-miR-373-3p	PAR-CLIP	21572407
MIRT509425	hsa-miR-520a-3p	PAR-CLIP	21572407
MIRT509424	hsa-miR-520b	PAR-CLIP	21572407
MIRT509423	hsa-miR-520c-3p	PAR-CLIP	21572407
MIRT509422	hsa-miR-520d-3p	PAR-CLIP	21572407
MIRT509421	hsa-miR-520e	PAR-CLIP	21572407
MIRT509420	hsa-miR-548p	PAR-CLIP	21572407
MIRT509419	hsa-miR-6085	PAR-CLIP	21572407
MIRT509418	hsa-miR-6813-5p	PAR-CLIP	21572407
MIRT509417	hsa-miR-6871-5p	PAR-CLIP	21572407
MIRT509416	hsa-miR-3184-5p	PAR-CLIP	21572407
MIRT509415	hsa-miR-423-5p	PAR-CLIP	21572407
MIRT509414	hsa-miR-548aj-5p	PAR-CLIP	21572407
MIRT509413	hsa-miR-548f-5p	PAR-CLIP	21572407
MIRT509412	hsa-miR-548g-5p	PAR-CLIP	21572407
MIRT509411	hsa-miR-548x-5p	PAR-CLIP	21572407
MIRT509410	hsa-miR-103a-3p	PAR-CLIP	21572407
MIRT509409	hsa-miR-107	PAR-CLIP	21572407
MIRT509408	hsa-miR-4268	PAR-CLIP	21572407
MIRT509407	hsa-miR-6878-5p	PAR-CLIP	21572407
MIRT509406	hsa-miR-6731-5p	PAR-CLIP	21572407
MIRT509405	hsa-miR-8085	PAR-CLIP	21572407
MIRT509404	hsa-miR-4283	PAR-CLIP	21572407
MIRT509403	hsa-miR-3944-5p	PAR-CLIP	21572407
MIRT509402	hsa-miR-4766-3p	PAR-CLIP	21572407
MIRT509401	hsa-miR-30c-1-3p	PAR-CLIP	21572407
MIRT509400	hsa-miR-30c-2-3p	PAR-CLIP	21572407
MIRT509399	hsa-miR-6788-5p	PAR-CLIP	21572407
MIRT509436	hsa-miR-583	PAR-CLIP	23446348
MIRT509435	hsa-miR-519a-3p	PAR-CLIP	23446348
MIRT509434	hsa-miR-519b-3p	PAR-CLIP	23446348
MIRT509433	hsa-miR-519c-3p	PAR-CLIP	23446348
MIRT509432	hsa-miR-302a-3p	PAR-CLIP	23446348
MIRT509431	hsa-miR-302b-3p	PAR-CLIP	23446348
MIRT509430	hsa-miR-302c-3p	PAR-CLIP	23446348
MIRT509429	hsa-miR-302d-3p	PAR-CLIP	23446348
MIRT509428	hsa-miR-302e	PAR-CLIP	23446348
MIRT509427	hsa-miR-372-3p	PAR-CLIP	23446348
MIRT509426	hsa-miR-373-3p	PAR-CLIP	23446348
MIRT509425	hsa-miR-520a-3p	PAR-CLIP	23446348
MIRT509424	hsa-miR-520b	PAR-CLIP	23446348
MIRT509423	hsa-miR-520c-3p	PAR-CLIP	23446348
MIRT509422	hsa-miR-520d-3p	PAR-CLIP	23446348
MIRT509421	hsa-miR-520e	PAR-CLIP	23446348
MIRT509420	hsa-miR-548p	PAR-CLIP	23446348
MIRT509419	hsa-miR-6085	PAR-CLIP	23446348
MIRT509418	hsa-miR-6813-5p	PAR-CLIP	23446348
MIRT509417	hsa-miR-6871-5p	PAR-CLIP	23446348
MIRT509416	hsa-miR-3184-5p	PAR-CLIP	23446348
MIRT509415	hsa-miR-423-5p	PAR-CLIP	23446348
MIRT509414	hsa-miR-548aj-5p	PAR-CLIP	23446348
MIRT509413	hsa-miR-548f-5p	PAR-CLIP	23446348
MIRT509412	hsa-miR-548g-5p	PAR-CLIP	23446348
MIRT509411	hsa-miR-548x-5p	PAR-CLIP	23446348
MIRT509410	hsa-miR-103a-3p	PAR-CLIP	23446348
MIRT509409	hsa-miR-107	PAR-CLIP	23446348
MIRT509408	hsa-miR-4268	PAR-CLIP	23446348
MIRT509407	hsa-miR-6878-5p	PAR-CLIP	23446348
MIRT509406	hsa-miR-6731-5p	PAR-CLIP	23446348
MIRT509405	hsa-miR-8085	PAR-CLIP	23446348
MIRT509404	hsa-miR-4283	PAR-CLIP	23446348
MIRT509403	hsa-miR-3944-5p	PAR-CLIP	23446348
MIRT509402	hsa-miR-4766-3p	PAR-CLIP	23446348
MIRT509401	hsa-miR-30c-1-3p	PAR-CLIP	23446348
MIRT509400	hsa-miR-30c-2-3p	PAR-CLIP	23446348
MIRT509399	hsa-miR-6788-5p	PAR-CLIP	23446348
MIRT1137782	hsa-miR-103a	CLIP-seq
MIRT1137783	hsa-miR-1283	CLIP-seq
MIRT1137784	hsa-miR-1915	CLIP-seq
MIRT1137785	hsa-miR-1972	CLIP-seq
MIRT1137786	hsa-miR-214	CLIP-seq
MIRT1137787	hsa-miR-296-3p	CLIP-seq
MIRT1137788	hsa-miR-302a	CLIP-seq
MIRT1137789	hsa-miR-302b	CLIP-seq
MIRT1137790	hsa-miR-302c	CLIP-seq
MIRT1137791	hsa-miR-302d	CLIP-seq
MIRT1137792	hsa-miR-3127-3p	CLIP-seq
MIRT1137793	hsa-miR-3184	CLIP-seq
MIRT1137794	hsa-miR-3619-5p	CLIP-seq
MIRT1137795	hsa-miR-3652	CLIP-seq
MIRT1137796	hsa-miR-3667-3p	CLIP-seq
MIRT1137797	hsa-miR-372	CLIP-seq
MIRT1137798	hsa-miR-373	CLIP-seq
MIRT1137799	hsa-miR-4430	CLIP-seq
MIRT1137800	hsa-miR-4530	CLIP-seq
MIRT1137801	hsa-miR-4684-3p	CLIP-seq
MIRT1137802	hsa-miR-4688	CLIP-seq
MIRT1137803	hsa-miR-4690-5p	CLIP-seq
MIRT1137804	hsa-miR-4751	CLIP-seq
MIRT1137805	hsa-miR-486-3p	CLIP-seq
MIRT1137806	hsa-miR-519a	CLIP-seq
MIRT1137807	hsa-miR-761	CLIP-seq
MIRT1137784	hsa-miR-1915	CLIP-seq
MIRT1137785	hsa-miR-1972	CLIP-seq
MIRT1137786	hsa-miR-214	CLIP-seq
MIRT1137787	hsa-miR-296-3p	CLIP-seq
MIRT1137792	hsa-miR-3127-3p	CLIP-seq
MIRT1137794	hsa-miR-3619-5p	CLIP-seq
MIRT1137800	hsa-miR-4530	CLIP-seq
MIRT1137802	hsa-miR-4688	CLIP-seq
MIRT2039121	hsa-miR-4749-3p	CLIP-seq
MIRT1137804	hsa-miR-4751	CLIP-seq
MIRT1137805	hsa-miR-486-3p	CLIP-seq
MIRT1137807	hsa-miR-761	CLIP-seq
MIRT1137782	hsa-miR-103a	CLIP-seq
MIRT1137783	hsa-miR-1283	CLIP-seq
MIRT1137785	hsa-miR-1972	CLIP-seq
MIRT1137786	hsa-miR-214	CLIP-seq
MIRT1137788	hsa-miR-302a	CLIP-seq
MIRT1137789	hsa-miR-302b	CLIP-seq
MIRT1137790	hsa-miR-302c	CLIP-seq
MIRT1137791	hsa-miR-302d	CLIP-seq
MIRT1137793	hsa-miR-3184	CLIP-seq
MIRT1137794	hsa-miR-3619-5p	CLIP-seq
MIRT1137796	hsa-miR-3667-3p	CLIP-seq
MIRT1137797	hsa-miR-372	CLIP-seq
MIRT1137798	hsa-miR-373	CLIP-seq
MIRT2269170	hsa-miR-3910	CLIP-seq
MIRT1137800	hsa-miR-4530	CLIP-seq
MIRT1137802	hsa-miR-4688	CLIP-seq
MIRT1137805	hsa-miR-486-3p	CLIP-seq
MIRT1137806	hsa-miR-519a	CLIP-seq
MIRT2269171	hsa-miR-548an	CLIP-seq
MIRT1137807	hsa-miR-761	CLIP-seq
MIRT1137784	hsa-miR-1915	CLIP-seq
MIRT1137785	hsa-miR-1972	CLIP-seq
MIRT1137786	hsa-miR-214	CLIP-seq
MIRT1137787	hsa-miR-296-3p	CLIP-seq
MIRT1137792	hsa-miR-3127-3p	CLIP-seq
MIRT1137794	hsa-miR-3619-5p	CLIP-seq
MIRT1137800	hsa-miR-4530	CLIP-seq
MIRT1137801	hsa-miR-4684-3p	CLIP-seq
MIRT1137802	hsa-miR-4688	CLIP-seq
MIRT2039121	hsa-miR-4749-3p	CLIP-seq
MIRT1137804	hsa-miR-4751	CLIP-seq
MIRT1137805	hsa-miR-486-3p	CLIP-seq
MIRT1137807	hsa-miR-761	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
MSC	Repression	15213307
MYCN	Activation	17826980
MYCN	Unknown	15668898
TP53	Repression	15899946

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000727	Process	Double-strand break repair via break-induced replication	IBA
GO:0000781	Component	Chromosome, telomeric region	HDA	19135898
GO:0000785	Component	Chromatin	TAS	8798650
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	TAS	15538388
GO:0003678	Function	DNA helicase activity	IDA	9305914, 25661590
GO:0003678	Function	DNA helicase activity	IEA
GO:0003678	Function	DNA helicase activity	IEA
GO:0003697	Function	Single-stranded DNA binding	IDA	25661590
GO:0003697	Function	Single-stranded DNA binding	IEA
GO:0003697	Function	Single-stranded DNA binding	ISS
GO:0004386	Function	Helicase activity	IEA
GO:0005515	Function	Protein binding	IPI	9705868, 10518787, 12364596, 15232106, 15538388, 15654075, 16289477, 16438930, 16899510, 16902406, 17296731, 17310990, 17314511, 19150984, 22540012, 23764002, 24299456, 25036637, 25416956, 26496610, 26871637, 28191891, 28514442, 31515488, 32296183, 32814053, 33654309, 33961781, 3527
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	21383955, 22474384
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0005730	Component	Nucleolus	IDA	21383955
GO:0006260	Process	DNA replication	IDA	22474384
GO:0006260	Process	DNA replication	IEA
GO:0006260	Process	DNA replication	IEA
GO:0006260	Process	DNA replication	TAS	8798650
GO:0006270	Process	DNA replication initiation	IBA
GO:0006270	Process	DNA replication initiation	IEA
GO:0006271	Process	DNA strand elongation involved in DNA replication	IBA
GO:0006974	Process	DNA damage response	IMP	15538388
GO:0008283	Process	Cell population proliferation	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016787	Function	Hydrolase activity	IEA
GO:0016887	Function	ATP hydrolysis activity	IEA
GO:0017116	Function	Single-stranded DNA helicase activity	IBA
GO:0030174	Process	Regulation of DNA-templated DNA replication initiation	NAS	30069701
GO:0042325	Process	Regulation of phosphorylation	IMP	15538388
GO:0042555	Component	MCM complex	IBA
GO:0042555	Component	MCM complex	IDA	17296731, 25661590
GO:0042555	Component	MCM complex	IEA
GO:0042555	Component	MCM complex	IMP	15538388
GO:0042555	Component	MCM complex	IPI	22540012
GO:0071162	Component	CMG complex	IPI	22474384
GO:0071162	Component	CMG complex	ISS
GO:0071364	Process	Cellular response to epidermal growth factor stimulus	IEA
GO:0071466	Process	Cellular response to xenobiotic stimulus	IEA

Other IDs

• MIM: 600592
• HGNC: 6950
• e!Ensembl: ENSG00000166508

Protein

• UniProt ID: P33993
• Protein name: DNA replication licensing factor MCM7 (EC 3.6.4.12) (CDC47 homolog) (P1.1-MCM3)
• Protein function: Acts as a component of the MCM2-7 complex (MCM complex) which is the replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. Core component of CDC45-MCM-GINS (CMG) helicase, the mol
• PDB: 6XTX, 6XTY, 7PFO, 7PLO, 7W1Y, 7W68, 8B9D, 8RWV, 8S09, 8S0A, 8S0B, 8S0D, 8S0E, 8S0F, 8W0E, 8W0F, 8W0G, 8W0I, 9CAQ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF14551	MCM_N	10 → 140	MCM N-terminal domain	Domain
  PF17207	MCM_OB	148 → 281	MCM OB domain	Domain
  PF00493	MCM	320 → 541	MCM P-loop domain	Domain
  PF17855	MCM_lid	557 → 641	MCM AAA-lid domain	Domain

• Sequence:

  MALKDYALEKEKVKKFLQEFYQDDELGKKQFKYGNQLVRLAHREQVALYVDLDDVAEDDP
  ELVDSICENARRYAKLFADAVQELLPQYKEREVVNKDVLDVYIEHRLMMEQRSRDPGMVR
  SPQNQYPAELMRRFELYFQGPSSNKPRVIREVRADSVGKLVTVRGIVTRVSEVKPKMVVA
  TYTCDQCGAETYQPIQSPTFMPLIMCPSQECQTNRSGGRLYLQTRGSRFIKFQEMKMQEH
  SDQVPVGNIPRSITVLVEGENTRIAQPGDHVSVTGIFLPILRTGFRQVVQGLLSETYLEA
  HRIVKMNKSEDDESGAGELTREELRQIAEEDFYEKLAASIAPEIYGHEDVKKALLLLLVG
  GVDQSPRGMKIRGNINICLMGDPGVAKSQLLSYIDRLAPRSQYTTGRGSSGVGLTAAVLR
  DSVSGELTLEGGALVLADQGVCCIDEFDKMAEADRTAIHEVMEQQTISIAKAGILTTLNA
  RCSILAAANPAYGRYNPRRSLEQNIQLPAALLSRFDLLWLIQDRPDRDNDLRLAQHITYV
  HQHSRQPPSQFEPLDMKLMRRYIAMCREKQPMVPESLADYITAAYVEMRREAWASKDATY
  TSARTLLAILRLSTALARLRMVDVVEKEDVNEAIRLMEMSKDSLLGDKGQTARTQRPADV
  IFATVRELVSGGRSVRFSEAEQRCVSRGFTPAQFQAALDEYEELNVWQVNASRTRITFV

• Sequence length: 719

Pathways

KEGG:

DNA replication
Cell cycle

Reactome:

Activation of ATR in response to replication stress
Assembly of the pre-replicative complex
Orc1 removal from chromatin
Activation of the pre-replicative complex
Switching of origins to a post-replicative state

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Meier-Gorlin syndrome	Pathogenic	rs778583017, rs76705400, rs758105856, rs1054083917	RCV001527364 RCV001527379 RCV001527378 RCV001527363	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANISOMETROPIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTIGMATISM	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOSOMAL RECESSIVE PRIMARY MICROCEPHALY	—	Disgenet, Orphanet Disgenet, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EAR, PATELLA, SHORT STATURE SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPEROPIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MCM7-related disorder	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MICROPHTHALMOS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TRICHIASIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Actinic keratosis	Actinic keratosis	BEFREE	27299186		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	29768346		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	31327484		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	17940502		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	19077563		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	31545501		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	29596435		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	LHGDN	16722928, 18465232		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	19077563, 28302537, 28432562		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	19031940	Stimulate	★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	29768346		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	20661220		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	19946466	Associate	★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	Pubtator	26823641	Associate	★☆☆☆☆ Found in Text Mining only
Anal carcinoma	Anal Cancer	BEFREE	28454340		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	15899946		★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	19920109	Stimulate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	30233242		★☆☆☆☆ Found in Text Mining only
Anophthalmia with pulmonary hypoplasia	Anophthalmia	Pubtator	39358545	Associate	★☆☆☆☆ Found in Text Mining only
Anus Neoplasms	Anus neoplasm	Pubtator	18349847	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	23618321	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	16446360	Associate	★☆☆☆☆ Found in Text Mining only
Autosomal dominant non-syndromic sensorineural deafness type DFNA	Non-Syndromic Sensorineural Deafness	Orphanet			★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	23098454		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	11839717, 27476776	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	12565771, 21619671, 26966728		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	21097442, 23764002, 26282201, 28084344, 28428557, 30358612, 31446607		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	16278669, 21097442, 26205655, 28084344, 31311202, 31476594, 32830194	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	15682442		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	20648010, 22393390, 24386425, 24416400, 26156831, 31653153	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	29651323	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	12565771, 19189662, 21947329, 28498460, 29661732		★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	21943228	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	32830194	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	20515756, 20515845, 22393390, 24416400, 25393367, 28182015, 29962817, 31011256, 31737652, 32108036, 32964028, 33499054, 34087888, 35093119, 39596041	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	17676583	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	26966728		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	27797825, 29038488, 29151950, 30174440		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	26889980, 38216547	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	15548371, 38423594	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	15814627, 37464398	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	11839717, 12966424, 16622441, 16832409, 27476776, 27748889, 31653153, 34609416, 35478139, 36445337, 37746664	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	31653153, 36445337	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	BEFREE	26889980		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	17947481, 29393493		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	14678972, 23874974, 24706378		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	14678972, 23874974, 24706378		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	29768346		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	20661220		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	20236609		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	35307646, 37305391	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	30714848		★☆☆☆☆ Found in Text Mining only
Ciliopathies	Ciliopathies	BEFREE	30329080		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	16629645		★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	34609416	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	26349972		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	18465232		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	CTD_human_DG	23770000		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	19077563, 21362268, 29179987		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	18636144, 19077563		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	19661314, 30937307, 31949199, 32612138, 34120619, 37370046	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	29651323	Stimulate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29180899		★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	19453809, 31535400		★☆☆☆☆ Found in Text Mining only
DEAFNESS, AUTOSOMAL DOMINANT 70	Deafness	UNIPROT_DG	26196677		★☆☆☆☆ Found in Text Mining only
DEAFNESS, AUTOSOMAL DOMINANT 70	Deafness	CLINGEN_DG	26196677		★☆☆☆☆ Found in Text Mining only
DEAFNESS, AUTOSOMAL DOMINANT 70	Deafness	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
DEAFNESS, AUTOSOMAL DOMINANT 70	Deafness	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	31535400		★☆☆☆☆ Found in Text Mining only
Desmoid disease hereditary	Desmoid tumor	Pubtator	21478101	Associate	★☆☆☆☆ Found in Text Mining only
Diarrhea 5 With Tufting Enteropathy Congenital	Congenital diarrhea	Pubtator	19293805, 36149152	Associate	★☆☆☆☆ Found in Text Mining only
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	16547620		★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	BEFREE	24137536		★☆☆☆☆ Found in Text Mining only
Dyskinesias	Dyskinesia	Pubtator	26712671	Associate	★☆☆☆☆ Found in Text Mining only
EAR, PATELLA, SHORT STATURE SYNDROME	Ear Diseases	BEFREE	24137536		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	23028803, 34859821	Associate	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	29393493		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	28498460		★☆☆☆☆ Found in Text Mining only
Esophageal Diseases	Esophageal disease	Pubtator	27476776	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	27476776	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	28498460		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	11839717	Associate	★☆☆☆☆ Found in Text Mining only
Extraskeletal Myxoid Chondrosarcoma	Extraskeletal Myxoid Chondrosarcoma	BEFREE	23028803		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi anemia	Pubtator	25662766	Associate	★☆☆☆☆ Found in Text Mining only
Fibromatosis, Aggressive	Fibromatosis	BEFREE	21478101		★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	27748889		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	27748889, 37480569	Associate	★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	24647462		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	16619508	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	25046975, 29665708		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	25046975	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	16959885		★☆☆☆☆ Found in Text Mining only
Hearing Loss	Hearing loss	Pubtator	35652205	Associate	★☆☆☆☆ Found in Text Mining only
Hearing Loss Sensorineural	Hearing loss	Pubtator	35652205	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	22393390, 31476594	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	28084344	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	18680610	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatomegaly	Hepatomegaly	Pubtator	37480569	Associate	★☆☆☆☆ Found in Text Mining only
Histiocytoma, Benign Fibrous	Benign fibrous histiocytoma	LHGDN	12119552		★☆☆☆☆ Found in Text Mining only
Hurthle Cell Tumor	Tumor	BEFREE	11948116		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	14511370	Associate	★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	26990745		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	11948116		★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	28032719		★☆☆☆☆ Found in Text Mining only
Laryngitis	Laryngitis	Pubtator	16832409	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	22556343, 34449552	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	28058629		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	30480765, 37358551	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	28045896		★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	22115939		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	28135012		★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	Pubtator	33654309	Associate	★☆☆☆☆ Found in Text Mining only
Liposarcoma	Liposarcoma	Pubtator	30317246	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	16629645, 20515756, 20515845, 25393367, 27065331, 29463213, 29750532, 30026832, 31034943, 31186405		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	16629645		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	16629645		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	21619671, 25393367		★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	21619671	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	21619671	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	17676583, 25045014, 27797825, 28465488, 29038488, 32469983, 32596300, 35360518	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	27797825		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	19189662, 27748889	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	19661314, 24386425	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	15682442, 19481678		★☆☆☆☆ Found in Text Mining only
Malignant Fibrous Histiocytoma	Malignant Histiocytoma	BEFREE	12119552		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	25046975		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	16959885		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	16278669, 21097442, 23764002, 26282201, 28084344, 28428557, 30358612		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	28498460		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	27748889		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	27797825, 29038488, 29151950, 30174440		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	28135012		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	16247466, 17406359, 18988800, 20332239, 22067725, 28628830		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	16547620		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	26966728		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11206334, 14550576, 14678972, 20236609, 20388916, 20440269, 21097442, 21619671, 21947329, 22685420, 22904560, 26990745, 27837251, 28081547, 29038488, 29888431		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	14678972, 23874974, 24706378		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	CTD_human_DG	23770000		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	26349972		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	30329080		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	20661220		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	18249467		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	31535400, 9371513		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	19877719, 24724603, 27868157		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	19877719	Stimulate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	37014425	Associate	★☆☆☆☆ Found in Text Mining only
Merkel cell carcinoma	Merkel cell carcinoma	BEFREE	19453809		★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	18988800		★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	BEFREE	30329080		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	16821635, 28135012	Associate	★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	22115939		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	16281941	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	25098679	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	37480569	Associate	★☆☆☆☆ Found in Text Mining only
Nemaline myopathy 5	Nemaline myopathy	Pubtator	17505513	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11206334, 11861392, 11948116, 12119552, 12565771, 14550576, 15668898, 16247466, 16278669, 16518415, 17308103, 17947481, 19240714, 19481678, 19920109, 20440269, 21619671, 21947329, 22493662, 22685420, 24516257, 24647462, 24706378, 25046975, 25372501, 27298561, 27748889, 28032719, 28045896, 28084344, 28300827, 28432562, 28460433, 28968952, 29151950, 29180899, 29463213, 29888431, 29963273, 30174440, 30359334, 30842144, 31446607		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	21703850		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	11861392, 15668898		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	21619671, 24763826, 24975429, 25738322, 29151950		★☆☆☆☆ Found in Text Mining only
Nonsyndromic Deafness	Nonsyndromic Deafness	BEFREE	26196677		★☆☆☆☆ Found in Text Mining only
Oculocutaneous albinism type 2	Oculocutaneous albinism	Pubtator	25046975	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	28460433		★☆☆☆☆ Found in Text Mining only
Ovarian clear cell carcinoma	Ovarian Carcinoma	BEFREE	29963273		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	26889980	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	17940502, 21076460, 31322224	Associate	★☆☆☆☆ Found in Text Mining only
Oxyphilic Adenoma	Oxyphilic Adenoma	BEFREE	11948116		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	25502777, 27695057, 29596435, 32420375	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	15899946		★☆☆☆☆ Found in Text Mining only
Peritoneal Neoplasms	Peritoneal neoplasm	Pubtator	26889980	Stimulate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	17698906, 25243570		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	37132453	Associate	★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	22158038		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	30646895		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	16247466, 17406359, 20332239, 22067725, 28628830		★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasia	Prostatic intraepithelial neoplasia	Pubtator	16545117	Stimulate	★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	20388916		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	11555583, 16545117, 17406359, 18676839, 34573332	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	16247466		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	18676839		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	11948116, 29180899		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	16556617, 20157412	Associate	★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	22564539, 25738322, 28300827		★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	21943228	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	12119552		★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	17464317	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	27216283		★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick sinus syndrome	Pubtator	36171622	Associate	★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	29845250, 29888431		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	25045014, 29845250, 34719665	Associate	★☆☆☆☆ Found in Text Mining only
Spastic Paraplegia-50, Autosomal Recessive	Spastic paraplegia	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	16518415, 19189662, 28498460, 29745471, 30359334, 31653153		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	19189662		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	28498460		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	12966424, 19189662, 19293805, 24386425, 26712671, 28032719, 30468474, 36149152, 37480569	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	34272446	Inhibit	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	30174440		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	27299186		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	26239836		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	19116018		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	21947329		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	28540486	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	18328430, 28540486, 31937549, 36171622	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	28059478		★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	17464317		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	16547620		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	16547620		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	37864896	Associate	★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	12565771		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	31476594	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	17505513, 18414413, 21619671, 23201130, 26966728	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	30150654	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	23874974, 24706378, 30150654, 31653153, 32181600, 33302814, 33413211, 33616161, 34404366, 37344577, 37746664, 38453655	Associate	★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	21866463	Associate	★☆☆☆☆ Found in Text Mining only