Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	4173
Gene name	Minichromosome maintenance complex component 4
Gene symbol	MCM4
Synonyms (NCBI Gene)	CDC21CDC54IMD54NKCDNKGCDP1-CDC21hCdc21
Chromosome	8
Chromosome location	8q11.21
Summary	The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of t

321

Show/Hide all (321)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016612	hsa-miR-193b-3p	Microarray	20304954
MIRT016612	hsa-miR-193b-3p	Proteomics	21512034
MIRT023946	hsa-miR-1-3p	Proteomics	18668040
MIRT025322	hsa-miR-34a-5p	Proteomics	21566225
MIRT025322	hsa-miR-34a-5p	Proteomics	21566225
MIRT030629	hsa-miR-24-3p	qRT-PCR;Microarray	19748357
MIRT052176	hsa-let-7b-5p	CLASH	23622248
MIRT052176	hsa-let-7b-5p	CLASH	23622248
MIRT047147	hsa-miR-183-5p	CLASH	23622248
MIRT044489	hsa-miR-320a	CLASH	23622248
MIRT042917	hsa-miR-324-3p	CLASH	23622248
MIRT042917	hsa-miR-324-3p	CLASH	23622248
MIRT042917	hsa-miR-324-3p	CLASH	23622248
MIRT038934	hsa-miR-31-3p	CLASH	23622248
MIRT037991	hsa-miR-501-3p	CLASH	23622248
MIRT642991	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT642990	hsa-miR-4485-5p	HITS-CLIP	23824327
MIRT642989	hsa-miR-1281	HITS-CLIP	23824327
MIRT642988	hsa-miR-6741-3p	HITS-CLIP	23824327
MIRT642987	hsa-miR-4638-5p	HITS-CLIP	23824327
MIRT642986	hsa-miR-2276-3p	HITS-CLIP	23824327
MIRT642985	hsa-miR-6791-3p	HITS-CLIP	23824327
MIRT642984	hsa-miR-6829-3p	HITS-CLIP	23824327
MIRT642983	hsa-miR-4284	HITS-CLIP	23824327
MIRT642982	hsa-miR-1206	HITS-CLIP	23824327
MIRT642981	hsa-miR-5571-3p	HITS-CLIP	23824327
MIRT549863	hsa-miR-548c-3p	PAR-CLIP	21572407
MIRT549862	hsa-miR-216b-5p	PAR-CLIP	21572407
MIRT549861	hsa-miR-3675-3p	PAR-CLIP	21572407
MIRT549860	hsa-miR-517-5p	PAR-CLIP	21572407
MIRT549859	hsa-miR-1251-5p	PAR-CLIP	21572407
MIRT549858	hsa-miR-539-5p	PAR-CLIP	21572407
MIRT225201	hsa-miR-633	PAR-CLIP	21572407
MIRT526159	hsa-miR-1285-5p	PAR-CLIP	22012620
MIRT244619	hsa-miR-3613-3p	PAR-CLIP	22012620
MIRT363888	hsa-miR-371b-5p	PAR-CLIP	22012620
MIRT363885	hsa-miR-373-5p	PAR-CLIP	22012620
MIRT363886	hsa-miR-616-5p	PAR-CLIP	22012620
MIRT526158	hsa-miR-371a-5p	PAR-CLIP	22012620
MIRT526157	hsa-miR-372-5p	PAR-CLIP	22012620
MIRT526156	hsa-miR-1301-5p	PAR-CLIP	22012620
MIRT526155	hsa-miR-6502-5p	PAR-CLIP	22012620
MIRT526154	hsa-miR-6822-3p	PAR-CLIP	22012620
MIRT244620	hsa-miR-5590-5p	PAR-CLIP	22012620
MIRT642991	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT642990	hsa-miR-4485-5p	HITS-CLIP	23824327
MIRT642989	hsa-miR-1281	HITS-CLIP	23824327
MIRT642988	hsa-miR-6741-3p	HITS-CLIP	23824327
MIRT642987	hsa-miR-4638-5p	HITS-CLIP	23824327
MIRT642986	hsa-miR-2276-3p	HITS-CLIP	23824327
MIRT642985	hsa-miR-6791-3p	HITS-CLIP	23824327
MIRT642984	hsa-miR-6829-3p	HITS-CLIP	23824327
MIRT642983	hsa-miR-4284	HITS-CLIP	23824327
MIRT642982	hsa-miR-1206	HITS-CLIP	23824327
MIRT642981	hsa-miR-5571-3p	HITS-CLIP	23824327
MIRT549863	hsa-miR-548c-3p	PAR-CLIP	21572407
MIRT549862	hsa-miR-216b-5p	PAR-CLIP	21572407
MIRT549861	hsa-miR-3675-3p	PAR-CLIP	21572407
MIRT549860	hsa-miR-517-5p	PAR-CLIP	21572407
MIRT549859	hsa-miR-1251-5p	PAR-CLIP	21572407
MIRT549858	hsa-miR-539-5p	PAR-CLIP	21572407
MIRT225201	hsa-miR-633	PAR-CLIP	21572407
MIRT526159	hsa-miR-1285-5p	PAR-CLIP	22012620
MIRT244619	hsa-miR-3613-3p	PAR-CLIP	22012620
MIRT363888	hsa-miR-371b-5p	PAR-CLIP	22012620
MIRT363885	hsa-miR-373-5p	PAR-CLIP	22012620
MIRT363886	hsa-miR-616-5p	PAR-CLIP	22012620
MIRT526158	hsa-miR-371a-5p	PAR-CLIP	22012620
MIRT526157	hsa-miR-372-5p	PAR-CLIP	22012620
MIRT526156	hsa-miR-1301-5p	PAR-CLIP	22012620
MIRT526155	hsa-miR-6502-5p	PAR-CLIP	22012620
MIRT526154	hsa-miR-6822-3p	PAR-CLIP	22012620
MIRT244620	hsa-miR-5590-5p	PAR-CLIP	22012620
MIRT1137681	hsa-miR-103a	CLIP-seq
MIRT1137682	hsa-miR-107	CLIP-seq
MIRT1137683	hsa-miR-1178	CLIP-seq
MIRT1137684	hsa-miR-1244	CLIP-seq
MIRT1137685	hsa-miR-1278	CLIP-seq
MIRT1137686	hsa-miR-1283	CLIP-seq
MIRT1137687	hsa-miR-1285	CLIP-seq
MIRT1137688	hsa-miR-1286	CLIP-seq
MIRT1137689	hsa-miR-1301	CLIP-seq
MIRT1137690	hsa-miR-142-3p	CLIP-seq
MIRT1137691	hsa-miR-1909	CLIP-seq
MIRT1137692	hsa-miR-197	CLIP-seq
MIRT1137693	hsa-miR-1976	CLIP-seq
MIRT1137694	hsa-miR-3135	CLIP-seq
MIRT1137695	hsa-miR-3187-5p	CLIP-seq
MIRT1137696	hsa-miR-3545-3p	CLIP-seq
MIRT1137697	hsa-miR-3614-3p	CLIP-seq
MIRT1137698	hsa-miR-3663-5p	CLIP-seq
MIRT1137699	hsa-miR-3667-3p	CLIP-seq
MIRT1137700	hsa-miR-3667-5p	CLIP-seq
MIRT1137701	hsa-miR-371-5p	CLIP-seq
MIRT1137702	hsa-miR-3929	CLIP-seq
MIRT1137703	hsa-miR-3944-5p	CLIP-seq
MIRT1137704	hsa-miR-4270	CLIP-seq
MIRT1137705	hsa-miR-4279	CLIP-seq
MIRT1137706	hsa-miR-4297	CLIP-seq
MIRT1137707	hsa-miR-4327	CLIP-seq
MIRT1137708	hsa-miR-433	CLIP-seq
MIRT1137709	hsa-miR-4419b	CLIP-seq
MIRT1137710	hsa-miR-4436a	CLIP-seq
MIRT1137711	hsa-miR-4441	CLIP-seq
MIRT1137712	hsa-miR-4457	CLIP-seq
MIRT1137713	hsa-miR-4467	CLIP-seq
MIRT1137714	hsa-miR-4478	CLIP-seq
MIRT1137715	hsa-miR-4503	CLIP-seq
MIRT1137716	hsa-miR-4635	CLIP-seq
MIRT1137717	hsa-miR-4680-5p	CLIP-seq
MIRT1137718	hsa-miR-4699-3p	CLIP-seq
MIRT1137719	hsa-miR-4714-3p	CLIP-seq
MIRT1137720	hsa-miR-4722-3p	CLIP-seq
MIRT1137721	hsa-miR-4735-5p	CLIP-seq
MIRT1137722	hsa-miR-4740-3p	CLIP-seq
MIRT1137723	hsa-miR-4775	CLIP-seq
MIRT1137724	hsa-miR-502-5p	CLIP-seq
MIRT1137725	hsa-miR-5047	CLIP-seq
MIRT1137726	hsa-miR-5096	CLIP-seq
MIRT1137727	hsa-miR-513a-3p	CLIP-seq
MIRT1137728	hsa-miR-513b	CLIP-seq
MIRT1137729	hsa-miR-587	CLIP-seq
MIRT1137730	hsa-miR-590-3p	CLIP-seq
MIRT1137731	hsa-miR-612	CLIP-seq
MIRT1137732	hsa-miR-640	CLIP-seq
MIRT1137733	hsa-miR-645	CLIP-seq
MIRT1137734	hsa-miR-661	CLIP-seq
MIRT1137681	hsa-miR-103a	CLIP-seq
MIRT1137682	hsa-miR-107	CLIP-seq
MIRT1137735	hsa-miR-1273f	CLIP-seq
MIRT1137736	hsa-miR-143	CLIP-seq
MIRT1137737	hsa-miR-3166	CLIP-seq
MIRT1137703	hsa-miR-3944-5p	CLIP-seq
MIRT1137713	hsa-miR-4467	CLIP-seq
MIRT1137718	hsa-miR-4699-3p	CLIP-seq
MIRT1137738	hsa-miR-4708-5p	CLIP-seq
MIRT1137739	hsa-miR-4770	CLIP-seq
MIRT1137740	hsa-miR-4771	CLIP-seq
MIRT2039107	hsa-miR-1228	CLIP-seq
MIRT1137687	hsa-miR-1285	CLIP-seq
MIRT1137689	hsa-miR-1301	CLIP-seq
MIRT2039108	hsa-miR-216a	CLIP-seq
MIRT2039109	hsa-miR-216b	CLIP-seq
MIRT2039110	hsa-miR-3065-3p	CLIP-seq
MIRT1137694	hsa-miR-3135	CLIP-seq
MIRT1137695	hsa-miR-3187-5p	CLIP-seq
MIRT1137707	hsa-miR-4327	CLIP-seq
MIRT1137725	hsa-miR-5047	CLIP-seq
MIRT1137731	hsa-miR-612	CLIP-seq
MIRT1137734	hsa-miR-661	CLIP-seq
MIRT1137681	hsa-miR-103a	CLIP-seq
MIRT1137682	hsa-miR-107	CLIP-seq
MIRT2269132	hsa-miR-122	CLIP-seq
MIRT2039107	hsa-miR-1228	CLIP-seq
MIRT1137684	hsa-miR-1244	CLIP-seq
MIRT2269133	hsa-miR-1251	CLIP-seq
MIRT1137685	hsa-miR-1278	CLIP-seq
MIRT1137686	hsa-miR-1283	CLIP-seq
MIRT1137688	hsa-miR-1286	CLIP-seq
MIRT1137691	hsa-miR-1909	CLIP-seq
MIRT1137693	hsa-miR-1976	CLIP-seq
MIRT2039108	hsa-miR-216a	CLIP-seq
MIRT2039109	hsa-miR-216b	CLIP-seq
MIRT2269134	hsa-miR-24	CLIP-seq
MIRT2269135	hsa-miR-2467-5p	CLIP-seq
MIRT2039110	hsa-miR-3065-3p	CLIP-seq
MIRT2269136	hsa-miR-3135b	CLIP-seq
MIRT1137737	hsa-miR-3166	CLIP-seq
MIRT2269137	hsa-miR-3188	CLIP-seq
MIRT2269138	hsa-miR-338-3p	CLIP-seq
MIRT2269139	hsa-miR-342-3p	CLIP-seq
MIRT2269140	hsa-miR-3647-3p	CLIP-seq
MIRT2269141	hsa-miR-3652	CLIP-seq
MIRT1137699	hsa-miR-3667-3p	CLIP-seq
MIRT1137703	hsa-miR-3944-5p	CLIP-seq
MIRT2269142	hsa-miR-3975	CLIP-seq
MIRT1137704	hsa-miR-4270	CLIP-seq
MIRT1137705	hsa-miR-4279	CLIP-seq
MIRT2269143	hsa-miR-4282	CLIP-seq
MIRT2269144	hsa-miR-4430	CLIP-seq
MIRT1137710	hsa-miR-4436a	CLIP-seq
MIRT2269145	hsa-miR-4438	CLIP-seq
MIRT1137711	hsa-miR-4441	CLIP-seq
MIRT1137715	hsa-miR-4503	CLIP-seq
MIRT2269146	hsa-miR-4505	CLIP-seq
MIRT2269147	hsa-miR-4530	CLIP-seq
MIRT2269148	hsa-miR-4634	CLIP-seq
MIRT2269149	hsa-miR-4649-3p	CLIP-seq
MIRT2269150	hsa-miR-4663	CLIP-seq
MIRT1137717	hsa-miR-4680-5p	CLIP-seq
MIRT1137718	hsa-miR-4699-3p	CLIP-seq
MIRT1137719	hsa-miR-4714-3p	CLIP-seq
MIRT1137720	hsa-miR-4722-3p	CLIP-seq
MIRT1137722	hsa-miR-4740-3p	CLIP-seq
MIRT1137740	hsa-miR-4771	CLIP-seq
MIRT2269151	hsa-miR-4797-5p	CLIP-seq
MIRT2269152	hsa-miR-485-5p	CLIP-seq
MIRT2269153	hsa-miR-491-3p	CLIP-seq
MIRT2269154	hsa-miR-5095	CLIP-seq
MIRT2269155	hsa-miR-539	CLIP-seq
MIRT2269156	hsa-miR-541	CLIP-seq
MIRT2269157	hsa-miR-570	CLIP-seq
MIRT2269158	hsa-miR-628-5p	CLIP-seq
MIRT2269159	hsa-miR-654-5p	CLIP-seq
MIRT2269160	hsa-miR-944	CLIP-seq
MIRT2269132	hsa-miR-122	CLIP-seq
MIRT2039107	hsa-miR-1228	CLIP-seq
MIRT2039108	hsa-miR-216a	CLIP-seq
MIRT2039109	hsa-miR-216b	CLIP-seq
MIRT2269135	hsa-miR-2467-5p	CLIP-seq
MIRT2039110	hsa-miR-3065-3p	CLIP-seq
MIRT2269136	hsa-miR-3135b	CLIP-seq
MIRT2269137	hsa-miR-3188	CLIP-seq
MIRT2269141	hsa-miR-3652	CLIP-seq
MIRT2269142	hsa-miR-3975	CLIP-seq
MIRT2269144	hsa-miR-4430	CLIP-seq
MIRT2269148	hsa-miR-4634	CLIP-seq
MIRT2269149	hsa-miR-4649-3p	CLIP-seq
MIRT2269150	hsa-miR-4663	CLIP-seq
MIRT2269152	hsa-miR-485-5p	CLIP-seq
MIRT2269158	hsa-miR-628-5p	CLIP-seq
MIRT1137683	hsa-miR-1178	CLIP-seq
MIRT1137691	hsa-miR-1909	CLIP-seq
MIRT1137697	hsa-miR-3614-3p	CLIP-seq
MIRT1137699	hsa-miR-3667-3p	CLIP-seq
MIRT1137704	hsa-miR-4270	CLIP-seq
MIRT1137706	hsa-miR-4297	CLIP-seq
MIRT1137711	hsa-miR-4441	CLIP-seq
MIRT1137712	hsa-miR-4457	CLIP-seq
MIRT1137724	hsa-miR-502-5p	CLIP-seq
MIRT1137728	hsa-miR-513b	CLIP-seq
MIRT2568388	hsa-miR-1225-3p	CLIP-seq
MIRT2039107	hsa-miR-1228	CLIP-seq
MIRT2568389	hsa-miR-1233	CLIP-seq
MIRT2269133	hsa-miR-1251	CLIP-seq
MIRT1137687	hsa-miR-1285	CLIP-seq
MIRT1137689	hsa-miR-1301	CLIP-seq
MIRT2568390	hsa-miR-199a-5p	CLIP-seq
MIRT2568391	hsa-miR-199b-5p	CLIP-seq
MIRT2039108	hsa-miR-216a	CLIP-seq
MIRT2039109	hsa-miR-216b	CLIP-seq
MIRT2568392	hsa-miR-219-5p	CLIP-seq
MIRT2039110	hsa-miR-3065-3p	CLIP-seq
MIRT1137694	hsa-miR-3135	CLIP-seq
MIRT1137695	hsa-miR-3187-5p	CLIP-seq
MIRT2568393	hsa-miR-3622a-3p	CLIP-seq
MIRT2568394	hsa-miR-3622b-3p	CLIP-seq
MIRT2269140	hsa-miR-3647-3p	CLIP-seq
MIRT1137700	hsa-miR-3667-5p	CLIP-seq
MIRT1137701	hsa-miR-371-5p	CLIP-seq
MIRT2568395	hsa-miR-4307	CLIP-seq
MIRT1137707	hsa-miR-4327	CLIP-seq
MIRT2568396	hsa-miR-4445	CLIP-seq
MIRT2568397	hsa-miR-4459	CLIP-seq
MIRT2568398	hsa-miR-4537	CLIP-seq
MIRT2568399	hsa-miR-4676-5p	CLIP-seq
MIRT2568400	hsa-miR-4684-5p	CLIP-seq
MIRT1137719	hsa-miR-4714-3p	CLIP-seq
MIRT1137722	hsa-miR-4740-3p	CLIP-seq
MIRT2568401	hsa-miR-4782-3p	CLIP-seq
MIRT2269151	hsa-miR-4797-5p	CLIP-seq
MIRT1137725	hsa-miR-5047	CLIP-seq
MIRT2568402	hsa-miR-508-3p	CLIP-seq
MIRT2269156	hsa-miR-541	CLIP-seq
MIRT2568403	hsa-miR-542-3p	CLIP-seq
MIRT2568404	hsa-miR-567	CLIP-seq
MIRT2568405	hsa-miR-575	CLIP-seq
MIRT1137731	hsa-miR-612	CLIP-seq
MIRT2269159	hsa-miR-654-5p	CLIP-seq
MIRT1137734	hsa-miR-661	CLIP-seq
MIRT2568406	hsa-miR-665	CLIP-seq
MIRT2568388	hsa-miR-1225-3p	CLIP-seq
MIRT2039107	hsa-miR-1228	CLIP-seq
MIRT2568389	hsa-miR-1233	CLIP-seq
MIRT2269133	hsa-miR-1251	CLIP-seq
MIRT1137687	hsa-miR-1285	CLIP-seq
MIRT1137689	hsa-miR-1301	CLIP-seq
MIRT1137693	hsa-miR-1976	CLIP-seq
MIRT2568390	hsa-miR-199a-5p	CLIP-seq
MIRT2568391	hsa-miR-199b-5p	CLIP-seq
MIRT2039108	hsa-miR-216a	CLIP-seq
MIRT2039109	hsa-miR-216b	CLIP-seq
MIRT2568392	hsa-miR-219-5p	CLIP-seq
MIRT2039110	hsa-miR-3065-3p	CLIP-seq
MIRT1137694	hsa-miR-3135	CLIP-seq
MIRT1137695	hsa-miR-3187-5p	CLIP-seq
MIRT2568393	hsa-miR-3622a-3p	CLIP-seq
MIRT2568394	hsa-miR-3622b-3p	CLIP-seq
MIRT2269140	hsa-miR-3647-3p	CLIP-seq
MIRT1137700	hsa-miR-3667-5p	CLIP-seq
MIRT1137701	hsa-miR-371-5p	CLIP-seq
MIRT1137705	hsa-miR-4279	CLIP-seq
MIRT2568395	hsa-miR-4307	CLIP-seq
MIRT1137707	hsa-miR-4327	CLIP-seq
MIRT2269145	hsa-miR-4438	CLIP-seq
MIRT2568396	hsa-miR-4445	CLIP-seq
MIRT2568397	hsa-miR-4459	CLIP-seq
MIRT1137715	hsa-miR-4503	CLIP-seq
MIRT2568398	hsa-miR-4537	CLIP-seq
MIRT2684736	hsa-miR-4632	CLIP-seq
MIRT2568399	hsa-miR-4676-5p	CLIP-seq
MIRT2568400	hsa-miR-4684-5p	CLIP-seq
MIRT1137719	hsa-miR-4714-3p	CLIP-seq
MIRT1137720	hsa-miR-4722-3p	CLIP-seq
MIRT1137721	hsa-miR-4735-5p	CLIP-seq
MIRT1137722	hsa-miR-4740-3p	CLIP-seq
MIRT2568401	hsa-miR-4782-3p	CLIP-seq
MIRT2684737	hsa-miR-4795-3p	CLIP-seq
MIRT2269151	hsa-miR-4797-5p	CLIP-seq
MIRT1137725	hsa-miR-5047	CLIP-seq
MIRT2568402	hsa-miR-508-3p	CLIP-seq
MIRT2269154	hsa-miR-5095	CLIP-seq
MIRT2269156	hsa-miR-541	CLIP-seq
MIRT2568403	hsa-miR-542-3p	CLIP-seq
MIRT2568404	hsa-miR-567	CLIP-seq
MIRT2568405	hsa-miR-575	CLIP-seq
MIRT1137731	hsa-miR-612	CLIP-seq
MIRT2684738	hsa-miR-629	CLIP-seq
MIRT2269159	hsa-miR-654-5p	CLIP-seq
MIRT1137734	hsa-miR-661	CLIP-seq
MIRT2568406	hsa-miR-665	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
MYCN	Activation	17826980

Show/Hide all (38)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000727	Process	Double-strand break repair via break-induced replication	IBA
GO:0000781	Component	Chromosome, telomeric region	HDA	19135898
GO:0003677	Function	DNA binding	IEA
GO:0003678	Function	DNA helicase activity	IDA	9305914, 25661590
GO:0003678	Function	DNA helicase activity	IEA
GO:0003678	Function	DNA helicase activity	IEA
GO:0003697	Function	Single-stranded DNA binding	IDA	25661590
GO:0003697	Function	Single-stranded DNA binding	IEA
GO:0003697	Function	Single-stranded DNA binding	ISS
GO:0004386	Function	Helicase activity	IEA
GO:0005515	Function	Protein binding	IPI	12364596, 15232106, 16902406, 17296731, 22190034, 22540012, 23764002, 24299456, 24407287, 25036637, 28514442, 33654309, 33961781, 35271311
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	22474384
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	8265339
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0006260	Process	DNA replication	IDA	22474384
GO:0006260	Process	DNA replication	IEA
GO:0006260	Process	DNA replication	IEA
GO:0006260	Process	DNA replication	NAS	9465298
GO:0006270	Process	DNA replication initiation	IEA
GO:0006271	Process	DNA strand elongation involved in DNA replication	IBA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016787	Function	Hydrolase activity	IEA
GO:0016887	Function	ATP hydrolysis activity	IEA
GO:0017116	Function	Single-stranded DNA helicase activity	IBA
GO:0030174	Process	Regulation of DNA-templated DNA replication initiation	NAS	30069701
GO:0042555	Component	MCM complex	IBA
GO:0042555	Component	MCM complex	IDA	17296731, 25661590
GO:0042555	Component	MCM complex	IEA
GO:0042555	Component	MCM complex	IPI	22540012
GO:0071162	Component	CMG complex	IPI	22474384
GO:0071162	Component	CMG complex	ISS
GO:1902975	Process	Mitotic DNA replication initiation	IBA

MIM	HGNC	e!Ensembl
602638	6947	ENSG00000104738

P33991

Protein name

DNA replication licensing factor MCM4 (EC 3.6.4.12) (CDC21 homolog) (P1-CDC21)

Protein function

Acts as a component of the MCM2-7 complex (MCM complex) which is the replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. Core component of CDC45-MCM-GINS (CMG) helicase, the mol

PDB

6XTX , 6XTY , 7PFO , 7PLO , 7W1Y , 7W68 , 8B9D , 8RWV , 8S09 , 8S0A , 8S0B , 8S0D , 8S0E , 8S0F , 8W0E , 8W0F , 8W0G , 8W0I , 9CAQ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF14551	MCM_N	163 → 264	MCM N-terminal domain	Domain
PF17207	MCM_OB	270 → 398	MCM OB domain	Domain
PF00493	MCM	445 → 670	MCM P-loop domain	Domain
PF17855	MCM_lid	685 → 769	MCM AAA-lid domain	Domain

Sequence

MSSPASTPSRRGSRRGRATPAQTPRSEDARSSPSQRRRGEDSTSTGELQPMPTSPGVDLQ
SPAAQDVLFSSPPQMHSSAIPLDFDVSSPLTYGTPSSRVEGTPRSGVRGTPVRQRPDLGS
AQKGLQVDLQSDGAAAEDIVASEQSLGQKLVIWGTDVNVAACKENFQRFLQRFIDPLAKE
EENVGIDITEPLYMQRLGEINVIGEPFLNVNCEHIKSFDKNLYRQLISYPQEVIPTFDMA
VNEIFFDRYPDSILEHQIQVRPFNALKTKNMRNLNPEDIDQLITISGMVIRTSQLIPEMQ
EAFFQCQVCAHTTRVEMDRGRIAEPSVCGRCHTTHSMALIHNRSLFSDKQMIKLQESPED
MPAGQTPHTVILFAHNDLVDKVQPGDRVNVTGIYRAVPIRVNPRVSNVKSVYKTHIDVIH
YRKTDAKRLHGLDEEAEQKLFSEKRVELLKELSRKPDIYERLASALAPSIYEHEDIKKGI
LLQLFGGTRKDFSHTGRGKFRAEINILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSA
VGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMNESTRSVLHEVMEQQTLSIAK
AGIICQLNARTSVLAAANPIESQWNPKKTTIENIQLPHTLLSRFDLIFLLLDPQDEAYDR
RLAHHLVALYYQSEEQAEEELLDMAVLKDYIAYAHSTIMPRLSEEASQALIEAYVDMRKI
GSSRGMVSAYPRQLESLIRLAEAHAKVRLSNKVEAIDVEEAKRLHREALKQSATDPRTGI
VDISILTTGMSATSRKRKEELAEALKKLILSKGKTPALKYQQLFEDIRGQSDIAITKDMF
EEALRALADDDFLTVTGKTVRLL

Sequence length

863

Interactions

View interactions

	KEGG		Reactome
	DNA replication Cell cycle		Activation of ATR in response to replication stress Assembly of the pre-replicative complex Orc1 removal from chromatin Activation of the pre-replicative complex Switching of origins to a post-replicative state

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Primary immunodeficiency with natural-killer cell deficiency and adrenal insufficiency	Pathogenic; Likely pathogenic	rs1563829725, rs1235010442	RCV000030799 RCV001195736	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Clear cell carcinoma of kidney	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IMMUNODEFICIENCY 54	—	CTD, HPO CTD, HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MCM4-related disorder	Likely benign; Uncertain significance; Conflicting classifications of pathogenicity; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Microcephaly	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NATURAL KILLER CELL DEFICIENCY, FAMILIAL ISOLATED	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (71)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Aarskog syndrome	Aarskog Syndrome	BEFREE	23279877, 23392095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	31323040, 31545501		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal cortical hypofunction	Adrenal Cortical Hypofunction	BEFREE	22354167, 22354170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	16051427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	36263058	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	27476776	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25733866, 31476594, 32830194	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	34895070	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	20648010, 24386425, 26156831, 28443473, 33107155	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	27350734	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	27350734, 32964028, 34961841	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	27476776	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	28443473, 31653153, 36445337	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	23874974, 26188903		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	23874974, 26188903		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	16051427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29987844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	30937307, 31387239	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29180899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	19453809		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	28812028	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	BEFREE	22354170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Diseases	Esophageal disease	Pubtator	27476776	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	27476776	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	22499342		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	37491836	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	33654309	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	31476594	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	33654309	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	29135113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	30480765	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	27350734, 30026832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	35360518	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24386425, 27476776	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	25661590		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	23874974, 26188903		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	16051427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	20398247	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	19877719		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	19877719	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Merkel cell carcinoma	Merkel cell carcinoma	BEFREE	19453809		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	25973099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	25973099	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Natural Killer Cell Deficiency, Familial Isolated	Natural killer cell and glucocorticoid deficiency with DNA repair defect	GENOMICS_ENGLAND_DG	16532402		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Natural Killer Cell Deficiency, Familial Isolated	Natural killer cell and glucocorticoid deficiency with DNA repair defect	ORPHANET_DG	22354170, 22405088		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Natural Killer Cell Deficiency, Familial Isolated	Natural killer cell and glucocorticoid deficiency with DNA repair defect	CLINVAR_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Natural Killer Cell Deficiency, Familial Isolated	Natural killer cell and glucocorticoid deficiency with DNA repair defect	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	16051427, 16595783, 19481678, 23874974		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	20884074		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	32193367, 38216092	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	27061550, 28537669, 28591191	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	27695057, 37198697	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary immunodeficiency with natural-killer cell deficiency and adrenal insufficiency	Immunodeficiency With Natural-Killer Cell Deficiency And Adrenal Insufficiency	Orphanet			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	33107155, 36035209	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29180899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	37737200	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	37667381	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	28443473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	31748958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	24386425, 29135113	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	22559327, 37737200	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	37864896	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	31476594, 40179432	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	18414413	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	30150654	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	23874974, 26188903, 30150654, 34404366	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	34151839	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
X-linked Adrenal Hypoplasia	Adrenal Hypoplasia, X-Linked	GENOMICS_ENGLAND_DG	22354170		★★★★★ ★☆☆☆☆ Found in Text Mining only

MCM4 (minichromosome maintenance complex component 4)