Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID	4162
Gene name	Melanoma cell adhesion molecule
Gene symbol	MCAM
Synonyms (NCBI Gene)	CD146HEMCAMMETCAMMUC18MelCAM
Chromosome	11
Chromosome location	11q23.3

310

Show/Hide all (310)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020604	hsa-miR-155-5p	Proteomics	18668040
MIRT022381	hsa-miR-124-3p	Proteomics;Microarray	18668037
MIRT023581	hsa-miR-1-3p	Proteomics	18668040
MIRT024589	hsa-miR-215-5p	Microarray	19074876
MIRT026263	hsa-miR-192-5p	Microarray	19074876
MIRT437805	hsa-miR-573	Luciferase reporter assayWestern blot	23670160
MIRT438650	hsa-miR-329-3p	ChIP-seqImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	23878390
MIRT438650	hsa-miR-329-3p	ChIP-seqImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	23878390
MIRT438650	hsa-miR-329-3p	ChIP-seqImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	23878390
MIRT438650	hsa-miR-329-3p	ChIP-seqImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	23878390
MIRT438650	hsa-miR-329-3p	ChIP-seqImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	23878390
MIRT438650	hsa-miR-329-3p	ChIP-seqImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	23878390
MIRT438650	hsa-miR-329-3p	ChIP-seqImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	23878390
MIRT438650	hsa-miR-329-3p	ChIP-seqImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	23878390
MIRT438650	hsa-miR-329-3p	ChIP-seqImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	23878390
MIRT438650	hsa-miR-329-3p	ChIP-seqImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	23878390
MIRT438650	hsa-miR-329-3p	ChIP-seqImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	23878390
MIRT438650	hsa-miR-329-3p	ChIP-seqImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	23878390
MIRT438650	hsa-miR-329-3p	ChIP-seqImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	23878390
MIRT438650	hsa-miR-329-3p	ChIP-seqImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	23878390
MIRT438650	hsa-miR-329-3p	ChIP-seqImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	23878390
MIRT438650	hsa-miR-329-3p	ChIP-seqImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	23878390
MIRT708051	hsa-miR-410-3p	HITS-CLIP	21572407
MIRT708050	hsa-miR-5580-3p	HITS-CLIP	21572407
MIRT708049	hsa-miR-142-5p	HITS-CLIP	21572407
MIRT708048	hsa-miR-5590-3p	HITS-CLIP	21572407
MIRT708047	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT708046	hsa-miR-340-5p	HITS-CLIP	21572407
MIRT708045	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT708044	hsa-miR-5007-3p	HITS-CLIP	21572407
MIRT708043	hsa-miR-335-3p	HITS-CLIP	21572407
MIRT708042	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT536070	hsa-miR-5693	PAR-CLIP	22012620
MIRT522562	hsa-miR-6499-3p	PAR-CLIP	22012620
MIRT522561	hsa-miR-3135b	PAR-CLIP	22012620
MIRT522560	hsa-miR-4294	PAR-CLIP	22012620
MIRT522559	hsa-miR-504-3p	PAR-CLIP	22012620
MIRT522558	hsa-miR-122-5p	PAR-CLIP	22012620
MIRT536068	hsa-miR-564	PAR-CLIP	22012620
MIRT522557	hsa-miR-3652	PAR-CLIP	22012620
MIRT522556	hsa-miR-4430	PAR-CLIP	22012620
MIRT522555	hsa-miR-143-5p	PAR-CLIP	22012620
MIRT536067	hsa-miR-891a-3p	PAR-CLIP	22012620
MIRT522554	hsa-miR-6501-5p	PAR-CLIP	22012620
MIRT522553	hsa-miR-4423-5p	PAR-CLIP	22012620
MIRT522552	hsa-miR-744-3p	PAR-CLIP	22012620
MIRT522549	hsa-miR-5698	PAR-CLIP	22012620
MIRT522562	hsa-miR-6499-3p	PAR-CLIP	23446348
MIRT522561	hsa-miR-3135b	PAR-CLIP	23446348
MIRT522560	hsa-miR-4294	PAR-CLIP	23446348
MIRT522559	hsa-miR-504-3p	PAR-CLIP	23446348
MIRT522558	hsa-miR-122-5p	PAR-CLIP	23446348
MIRT522557	hsa-miR-3652	PAR-CLIP	23446348
MIRT522556	hsa-miR-4430	PAR-CLIP	23446348
MIRT522555	hsa-miR-143-5p	PAR-CLIP	23446348
MIRT522554	hsa-miR-6501-5p	PAR-CLIP	23446348
MIRT522553	hsa-miR-4423-5p	PAR-CLIP	23446348
MIRT522552	hsa-miR-744-3p	PAR-CLIP	23446348
MIRT522551	hsa-miR-670-3p	PAR-CLIP	23446348
MIRT522550	hsa-miR-1238-3p	PAR-CLIP	23446348
MIRT522549	hsa-miR-5698	PAR-CLIP	23446348
MIRT708051	hsa-miR-410-3p	HITS-CLIP	21572407
MIRT708050	hsa-miR-5580-3p	HITS-CLIP	21572407
MIRT708049	hsa-miR-142-5p	HITS-CLIP	21572407
MIRT708048	hsa-miR-5590-3p	HITS-CLIP	21572407
MIRT708047	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT708046	hsa-miR-340-5p	HITS-CLIP	21572407
MIRT708045	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT708044	hsa-miR-5007-3p	HITS-CLIP	21572407
MIRT708043	hsa-miR-335-3p	HITS-CLIP	21572407
MIRT708042	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT536070	hsa-miR-5693	PAR-CLIP	22012620
MIRT522562	hsa-miR-6499-3p	PAR-CLIP	22012620
MIRT522561	hsa-miR-3135b	PAR-CLIP	22012620
MIRT522560	hsa-miR-4294	PAR-CLIP	22012620
MIRT522559	hsa-miR-504-3p	PAR-CLIP	22012620
MIRT522558	hsa-miR-122-5p	PAR-CLIP	22012620
MIRT536068	hsa-miR-564	PAR-CLIP	22012620
MIRT522557	hsa-miR-3652	PAR-CLIP	22012620
MIRT522556	hsa-miR-4430	PAR-CLIP	22012620
MIRT522555	hsa-miR-143-5p	PAR-CLIP	22012620
MIRT536067	hsa-miR-891a-3p	PAR-CLIP	22012620
MIRT522554	hsa-miR-6501-5p	PAR-CLIP	22012620
MIRT522553	hsa-miR-4423-5p	PAR-CLIP	22012620
MIRT522552	hsa-miR-744-3p	PAR-CLIP	22012620
MIRT522549	hsa-miR-5698	PAR-CLIP	22012620
MIRT522562	hsa-miR-6499-3p	PAR-CLIP	23446348
MIRT522561	hsa-miR-3135b	PAR-CLIP	23446348
MIRT522560	hsa-miR-4294	PAR-CLIP	23446348
MIRT522559	hsa-miR-504-3p	PAR-CLIP	23446348
MIRT522558	hsa-miR-122-5p	PAR-CLIP	23446348
MIRT522557	hsa-miR-3652	PAR-CLIP	23446348
MIRT522556	hsa-miR-4430	PAR-CLIP	23446348
MIRT522555	hsa-miR-143-5p	PAR-CLIP	23446348
MIRT522554	hsa-miR-6501-5p	PAR-CLIP	23446348
MIRT522553	hsa-miR-4423-5p	PAR-CLIP	23446348
MIRT522552	hsa-miR-744-3p	PAR-CLIP	23446348
MIRT522551	hsa-miR-670-3p	PAR-CLIP	23446348
MIRT522550	hsa-miR-1238-3p	PAR-CLIP	23446348
MIRT522549	hsa-miR-5698	PAR-CLIP	23446348
MIRT1136319	hsa-miR-1203	CLIP-seq
MIRT1136320	hsa-miR-1207-5p	CLIP-seq
MIRT1136321	hsa-miR-129-5p	CLIP-seq
MIRT1136322	hsa-miR-3149	CLIP-seq
MIRT1136323	hsa-miR-3656	CLIP-seq
MIRT1136324	hsa-miR-411	CLIP-seq
MIRT1136325	hsa-miR-4455	CLIP-seq
MIRT1136326	hsa-miR-4678	CLIP-seq
MIRT1136327	hsa-miR-4699-3p	CLIP-seq
MIRT1136328	hsa-miR-4722-5p	CLIP-seq
MIRT1136329	hsa-miR-4735-5p	CLIP-seq
MIRT1136330	hsa-miR-4736	CLIP-seq
MIRT1136331	hsa-miR-4763-3p	CLIP-seq
MIRT1136332	hsa-miR-4775	CLIP-seq
MIRT1136333	hsa-miR-5096	CLIP-seq
MIRT1136334	hsa-miR-590-3p	CLIP-seq
MIRT1136335	hsa-miR-720	CLIP-seq
MIRT1556657	hsa-miR-1184	CLIP-seq
MIRT1556658	hsa-miR-1293	CLIP-seq
MIRT1556659	hsa-miR-1301	CLIP-seq
MIRT1556660	hsa-miR-141	CLIP-seq
MIRT1556661	hsa-miR-200a	CLIP-seq
MIRT1556662	hsa-miR-296-3p	CLIP-seq
MIRT1556663	hsa-miR-4260	CLIP-seq
MIRT1556664	hsa-miR-4418	CLIP-seq
MIRT1556665	hsa-miR-4459	CLIP-seq
MIRT1556666	hsa-miR-4483	CLIP-seq
MIRT1556667	hsa-miR-4660	CLIP-seq
MIRT1556668	hsa-miR-4768-5p	CLIP-seq
MIRT1556669	hsa-miR-4779	CLIP-seq
MIRT1556670	hsa-miR-5047	CLIP-seq
MIRT1556671	hsa-miR-509-3-5p	CLIP-seq
MIRT1556672	hsa-miR-509-5p	CLIP-seq
MIRT1556673	hsa-miR-885-3p	CLIP-seq
MIRT2038806	hsa-miR-106a	CLIP-seq
MIRT2038807	hsa-miR-106b	CLIP-seq
MIRT1556657	hsa-miR-1184	CLIP-seq
MIRT2038808	hsa-miR-1193	CLIP-seq
MIRT2038809	hsa-miR-122	CLIP-seq
MIRT2038810	hsa-miR-1228	CLIP-seq
MIRT2038811	hsa-miR-1234	CLIP-seq
MIRT2038812	hsa-miR-1299	CLIP-seq
MIRT1556659	hsa-miR-1301	CLIP-seq
MIRT2038813	hsa-miR-1307	CLIP-seq
MIRT2038814	hsa-miR-150	CLIP-seq
MIRT2038815	hsa-miR-17	CLIP-seq
MIRT2038816	hsa-miR-20a	CLIP-seq
MIRT2038817	hsa-miR-20b	CLIP-seq
MIRT2038818	hsa-miR-2276	CLIP-seq
MIRT2038819	hsa-miR-2392	CLIP-seq
MIRT2038820	hsa-miR-302a	CLIP-seq
MIRT2038821	hsa-miR-302b	CLIP-seq
MIRT2038822	hsa-miR-302c	CLIP-seq
MIRT2038823	hsa-miR-302d	CLIP-seq
MIRT2038824	hsa-miR-302e	CLIP-seq
MIRT2038825	hsa-miR-3152-3p	CLIP-seq
MIRT2038826	hsa-miR-372	CLIP-seq
MIRT2038827	hsa-miR-373	CLIP-seq
MIRT2038828	hsa-miR-3907	CLIP-seq
MIRT2038829	hsa-miR-410	CLIP-seq
MIRT2038830	hsa-miR-4284	CLIP-seq
MIRT1556664	hsa-miR-4418	CLIP-seq
MIRT2038831	hsa-miR-4638-5p	CLIP-seq
MIRT1556667	hsa-miR-4660	CLIP-seq
MIRT2038832	hsa-miR-4662a-5p	CLIP-seq
MIRT2038833	hsa-miR-4676-5p	CLIP-seq
MIRT2038834	hsa-miR-4707-3p	CLIP-seq
MIRT2038835	hsa-miR-4731-5p	CLIP-seq
MIRT2038836	hsa-miR-4782-5p	CLIP-seq
MIRT1556670	hsa-miR-5047	CLIP-seq
MIRT1556671	hsa-miR-509-3-5p	CLIP-seq
MIRT1556672	hsa-miR-509-5p	CLIP-seq
MIRT2038837	hsa-miR-512-3p	CLIP-seq
MIRT2038838	hsa-miR-516b	CLIP-seq
MIRT2038839	hsa-miR-519d	CLIP-seq
MIRT2038840	hsa-miR-520a-3p	CLIP-seq
MIRT2038841	hsa-miR-520b	CLIP-seq
MIRT2038842	hsa-miR-520c-3p	CLIP-seq
MIRT2038843	hsa-miR-520d-3p	CLIP-seq
MIRT2038844	hsa-miR-520e	CLIP-seq
MIRT2038845	hsa-miR-520g	CLIP-seq
MIRT2038846	hsa-miR-520h	CLIP-seq
MIRT2038847	hsa-miR-575	CLIP-seq
MIRT2038848	hsa-miR-93	CLIP-seq
MIRT2038806	hsa-miR-106a	CLIP-seq
MIRT2038807	hsa-miR-106b	CLIP-seq
MIRT2038810	hsa-miR-1228	CLIP-seq
MIRT2038811	hsa-miR-1234	CLIP-seq
MIRT2038813	hsa-miR-1307	CLIP-seq
MIRT2268803	hsa-miR-1324	CLIP-seq
MIRT2038814	hsa-miR-150	CLIP-seq
MIRT2038815	hsa-miR-17	CLIP-seq
MIRT2038816	hsa-miR-20a	CLIP-seq
MIRT2038817	hsa-miR-20b	CLIP-seq
MIRT2038818	hsa-miR-2276	CLIP-seq
MIRT2038820	hsa-miR-302a	CLIP-seq
MIRT2038821	hsa-miR-302b	CLIP-seq
MIRT2038822	hsa-miR-302c	CLIP-seq
MIRT2038823	hsa-miR-302d	CLIP-seq
MIRT2038824	hsa-miR-302e	CLIP-seq
MIRT2038825	hsa-miR-3152-3p	CLIP-seq
MIRT2268804	hsa-miR-329	CLIP-seq
MIRT2268805	hsa-miR-362-3p	CLIP-seq
MIRT2038826	hsa-miR-372	CLIP-seq
MIRT2038827	hsa-miR-373	CLIP-seq
MIRT2268806	hsa-miR-3941	CLIP-seq
MIRT1136324	hsa-miR-411	CLIP-seq
MIRT2038830	hsa-miR-4284	CLIP-seq
MIRT2268807	hsa-miR-4438	CLIP-seq
MIRT2268808	hsa-miR-4454	CLIP-seq
MIRT2038831	hsa-miR-4638-5p	CLIP-seq
MIRT2038832	hsa-miR-4662a-5p	CLIP-seq
MIRT2038833	hsa-miR-4676-5p	CLIP-seq
MIRT2038834	hsa-miR-4707-3p	CLIP-seq
MIRT2038835	hsa-miR-4731-5p	CLIP-seq
MIRT2268809	hsa-miR-5095	CLIP-seq
MIRT1136333	hsa-miR-5096	CLIP-seq
MIRT2038837	hsa-miR-512-3p	CLIP-seq
MIRT2038839	hsa-miR-519d	CLIP-seq
MIRT2038840	hsa-miR-520a-3p	CLIP-seq
MIRT2038841	hsa-miR-520b	CLIP-seq
MIRT2038842	hsa-miR-520c-3p	CLIP-seq
MIRT2038843	hsa-miR-520d-3p	CLIP-seq
MIRT2038844	hsa-miR-520e	CLIP-seq
MIRT2038845	hsa-miR-520g	CLIP-seq
MIRT2038846	hsa-miR-520h	CLIP-seq
MIRT2038847	hsa-miR-575	CLIP-seq
MIRT2268810	hsa-miR-603	CLIP-seq
MIRT2268811	hsa-miR-758	CLIP-seq
MIRT2038848	hsa-miR-93	CLIP-seq
MIRT1556658	hsa-miR-1293	CLIP-seq
MIRT2038813	hsa-miR-1307	CLIP-seq
MIRT1556660	hsa-miR-141	CLIP-seq
MIRT1556661	hsa-miR-200a	CLIP-seq
MIRT2038818	hsa-miR-2276	CLIP-seq
MIRT2038830	hsa-miR-4284	CLIP-seq
MIRT1556665	hsa-miR-4459	CLIP-seq
MIRT1556666	hsa-miR-4483	CLIP-seq
MIRT2038831	hsa-miR-4638-5p	CLIP-seq
MIRT1556669	hsa-miR-4779	CLIP-seq
MIRT2038809	hsa-miR-122	CLIP-seq
MIRT1136335	hsa-miR-720	CLIP-seq
MIRT2568149	hsa-miR-1251	CLIP-seq
MIRT2568150	hsa-miR-125a-5p	CLIP-seq
MIRT2568151	hsa-miR-125b	CLIP-seq
MIRT2568152	hsa-miR-1291	CLIP-seq
MIRT1556658	hsa-miR-1293	CLIP-seq
MIRT2268803	hsa-miR-1324	CLIP-seq
MIRT2568153	hsa-miR-1343	CLIP-seq
MIRT2568154	hsa-miR-1827	CLIP-seq
MIRT1556662	hsa-miR-296-3p	CLIP-seq
MIRT2568155	hsa-miR-296-5p	CLIP-seq
MIRT2568156	hsa-miR-3166	CLIP-seq
MIRT2268804	hsa-miR-329	CLIP-seq
MIRT2268805	hsa-miR-362-3p	CLIP-seq
MIRT2568157	hsa-miR-3674	CLIP-seq
MIRT2568158	hsa-miR-4256	CLIP-seq
MIRT1556663	hsa-miR-4260	CLIP-seq
MIRT2568159	hsa-miR-4319	CLIP-seq
MIRT2568160	hsa-miR-4453	CLIP-seq
MIRT1556665	hsa-miR-4459	CLIP-seq
MIRT1556666	hsa-miR-4483	CLIP-seq
MIRT2568161	hsa-miR-4538	CLIP-seq
MIRT2038833	hsa-miR-4676-5p	CLIP-seq
MIRT2568162	hsa-miR-4709-3p	CLIP-seq
MIRT2568163	hsa-miR-4747-3p	CLIP-seq
MIRT2568164	hsa-miR-4755-3p	CLIP-seq
MIRT2568165	hsa-miR-4768-3p	CLIP-seq
MIRT1556668	hsa-miR-4768-5p	CLIP-seq
MIRT1556669	hsa-miR-4779	CLIP-seq
MIRT2568166	hsa-miR-513a-5p	CLIP-seq
MIRT2038847	hsa-miR-575	CLIP-seq
MIRT2568167	hsa-miR-579	CLIP-seq
MIRT2568168	hsa-miR-587	CLIP-seq
MIRT1136335	hsa-miR-720	CLIP-seq
MIRT1556673	hsa-miR-885-3p	CLIP-seq
MIRT2038809	hsa-miR-122	CLIP-seq
MIRT2568149	hsa-miR-1251	CLIP-seq
MIRT2568150	hsa-miR-125a-5p	CLIP-seq
MIRT2568151	hsa-miR-125b	CLIP-seq
MIRT2568152	hsa-miR-1291	CLIP-seq
MIRT1556658	hsa-miR-1293	CLIP-seq
MIRT2268803	hsa-miR-1324	CLIP-seq
MIRT2568153	hsa-miR-1343	CLIP-seq
MIRT2568154	hsa-miR-1827	CLIP-seq
MIRT1556662	hsa-miR-296-3p	CLIP-seq
MIRT2568155	hsa-miR-296-5p	CLIP-seq
MIRT2568156	hsa-miR-3166	CLIP-seq
MIRT2268804	hsa-miR-329	CLIP-seq
MIRT2268805	hsa-miR-362-3p	CLIP-seq
MIRT2568157	hsa-miR-3674	CLIP-seq
MIRT2568158	hsa-miR-4256	CLIP-seq
MIRT1556663	hsa-miR-4260	CLIP-seq
MIRT2568159	hsa-miR-4319	CLIP-seq
MIRT2568160	hsa-miR-4453	CLIP-seq
MIRT1556665	hsa-miR-4459	CLIP-seq
MIRT1556666	hsa-miR-4483	CLIP-seq
MIRT2568161	hsa-miR-4538	CLIP-seq
MIRT2038833	hsa-miR-4676-5p	CLIP-seq
MIRT2568162	hsa-miR-4709-3p	CLIP-seq
MIRT2568163	hsa-miR-4747-3p	CLIP-seq
MIRT2568164	hsa-miR-4755-3p	CLIP-seq
MIRT2568165	hsa-miR-4768-3p	CLIP-seq
MIRT1556668	hsa-miR-4768-5p	CLIP-seq
MIRT1556669	hsa-miR-4779	CLIP-seq
MIRT2568166	hsa-miR-513a-5p	CLIP-seq
MIRT2038847	hsa-miR-575	CLIP-seq
MIRT2568167	hsa-miR-579	CLIP-seq
MIRT2568168	hsa-miR-587	CLIP-seq
MIRT1556673	hsa-miR-885-3p	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
TFAP2A	Repression	20805990

Show/Hide all (17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IBA
GO:0001525	Process	Angiogenesis	IDA	23878390
GO:0003094	Process	Glomerular filtration	IEP	20354148
GO:0005055	Function	Laminin receptor activity	IBA
GO:0005515	Function	Protein binding	IPI	36739428
GO:0005576	Component	Extracellular region	HDA	27068509
GO:0005615	Component	Extracellular space	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	NAS	8378324
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0007155	Process	Cell adhesion	IEA
GO:0007155	Process	Cell adhesion	TAS	8378324
GO:0009653	Process	Anatomical structure morphogenesis	TAS	8378324
GO:0009897	Component	External side of plasma membrane	IDA	20354148
GO:0016020	Component	Membrane	IEA
GO:0030335	Process	Positive regulation of cell migration	IEA
GO:0061042	Process	Vascular wound healing	IEP	20354148

MIM	HGNC	e!Ensembl
155735	6934	ENSG00000076706

P43121

Protein name

Cell surface glycoprotein MUC18 (Cell surface glycoprotein P1H12) (Melanoma cell adhesion molecule) (Melanoma-associated antigen A32) (Melanoma-associated antigen MUC18) (S-endo 1 endothelial-associated antigen) (CD antigen CD146)

Protein function

Plays a role in cell adhesion, and in cohesion of the endothelial monolayer at intercellular junctions in vascular tissue. Its expression may allow melanoma cells to interact with cellular elements of the vascular system, thereby enhancing hemat

PDB

6LYN

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07686	V-set	30 → 133	Immunoglobulin V-set domain	Domain
PF08205	C2-set_2	139 → 234	CD80-like C2-set immunoglobulin domain	Domain
PF13927	Ig_3	253 → 322		Domain
PF00047	ig	348 → 421	Immunoglobulin domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in endothelial cells in vascular tissue throughout the body. May appear at the surface of neural crest cells during their embryonic migration. Appears to be limited to vascular smooth muscle in normal adult tissues. Associated

Sequence

MGLPRLVCAFLLAACCCCPRVAGVPGEAEQPAPELVEVEVGSTALLKCGLSQSQGNLSHV
DWFSVHKEKRTLIFRVRQGQGQSEPGEYEQRLSLQDRGATLALTQVTPQDERIFLCQGKR
PRSQEYRIQLRVYKAPEEPNIQVNPLGIPVNSKEPEEVATCVGRNGYPIPQVIWYKNGRP
LKEEKNRVHIQSSQTVESSGLYTLQSILKAQLVKEDKDAQFYCELNYRLPSGNHMKESRE
VTVPVFYPTEKVWLEVEPVGMLKEGDRVEIRCLADGNPPPHFSISKQNPSTREAEEETTN
DNGVLVLEPARKEHSGRYECQGLDLDTMISLLSEPQELLVNYVSDVRVSPAAPERQEGSS
LTLTCEAESSQDLEFQWLREETGQVLERGPVLQLHDLKREAGGGYRCVASVPSIPGLNRT
QLVNVAIFGPPWMAFKERKVWVKENMVLNLSCEASGHPRPTISWNVNGTASEQDQDPQRV
LSTLNVLVTPELLETGVECTASNDLGKNTSILFLELVNLTTLTPDSNTTTGLSTSTASPH
TRANSTSTERKLPEPESRGVVIVAVIVCILVLAVLGAVLYFLYKKGKLPCRRSGKQEITL
PPSRKSELVVEVKSDKLPEEMGLLQGSSGDKRAPGDQGEKYIDLRH

Sequence length

646

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AUTOIMMUNE DISEASES OF THE NERVOUS SYSTEM	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MESOTHELIOMA, MALIGNANT	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERITONEAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (188)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	22076922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	BEFREE	19200179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	19200179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	25113810		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	28351381		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	25729916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Diseases	Aortic Diseases	BEFREE	25729916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	19200179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	28084332, 30928429		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	25113810		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	25113810, 26841872	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	10211875, 25113810	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	34491483	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10211875	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	10211875, 25113810		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	23256918, 27701461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	24612514	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	28084332, 30928429		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	21959269		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	21959269	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases of the Nervous System	Autoimmune Nervous System Disorder	CTD_human_DG	23595028		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Behcet Syndrome	Behcet Syndrome	BEFREE	21959269		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	21959269	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	24681356	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	31147874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	21694441		★★★★★ ★☆☆☆☆ Found in Text Mining only
Birdshot Chorioretinopathy	Birdshot chorioretinopathy	Pubtator	24681356	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	27280694	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	31147892		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10451481, 19123925, 20379845, 21450088, 22051146, 22057013, 22210108, 22952755, 25728681, 27565656, 27702820, 27838413, 28347241, 29028085, 29121955, 29734758, 31100639, 31826047 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19123925, 21450088, 22952755, 26695635, 27702820, 27838413, 28347241, 29028085, 31826047, 35012489	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	29121955	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchiolitis Obliterans	Bronchiolitis Obliterans	BEFREE	28614794		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cancer of Digestive System	Gastric Cancer	BEFREE	28652617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	21450088, 22330345	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	23125005	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	25997612	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	39992088	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28652617, 28825843, 30480362, 30675274, 31572064		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	19079610, 25510693	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	25184692, 26617818, 28626293, 32245446	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	10951239, 12632016	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	10951239		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	19123925, 22610942, 26906545, 30274262, 30675307		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinomatosis of peritoneal cavity	Peritoneal Carcinomatosis	CTD_human_DG	22784439, 23621518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	34565470	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	24612514	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	24612514	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	30001528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	22955913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	14516134, 23649916, 27701461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	25728681		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	24236063	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	39261771	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Connective Tissue Diseases	Connective tissue disease	Pubtator	23738744	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	22826148, 28626293, 29541188, 29721091		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	30372812	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Craniopharyngioma	Pubtator	24934367	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	21959269		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	21959269	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	30904617, 9632718, 9810513		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	10211875		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	10951239		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	22740707	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	30001528	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	LHGDN	17490776		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	30001528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	19228591	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	30675307		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	28319067		★★★★★ ★☆☆☆☆ Found in Text Mining only
Exudative age-related macular degeneration	Exudative Macular Degeneration	BEFREE	30918816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	23011890	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	27280694	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	27280694	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	31147892		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	28852198		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	32059574	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	19123925	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydatidiform Mole	Hydatidiform mole	Pubtator	34057923	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperkinesis	Hyperkinesia	Pubtator	23738744	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	25606985	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	31391533, 31488850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune Disorders, Nervous System	Immune Disorders, Nervous System	CTD_human_DG	23595028		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	31002939		★★★★★ ★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	22051146, 26373617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	30001528	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	LHGDN	14597988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	26293576	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	26102234	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	31102047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	25728681, 26004137, 26928402, 30419801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	25728681		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	39992088	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	25331524	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	37327339	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	23256918		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26293576	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	39261771	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	CTD_human_DG	22784439, 23621518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19123925, 20379845, 21450088, 22051146, 22057013, 22210108, 22952755, 25728681, 27565656, 27702820, 27838413, 28347241, 29028085, 29121955, 29734758, 31100639, 31826047 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	16540638, 24236063		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28652617, 28825843, 30480362, 30675274, 31572064		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	31102047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	19123925, 22610942, 26906545, 30274262		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	26373617, 27583552		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11536311, 11722842, 14980717, 18196513, 19123925, 21334670, 25729916, 28147335, 30745464, 31092432, 31826047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	26928402		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10362144, 10451481, 11536311, 14534536, 16914572, 20884621, 22051146, 22610942, 26373617, 26484608, 26906545, 28646020, 29348825, 29734758, 29777784 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	19123925, 22210108, 29121955		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	20421967, 2602381		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	10211875, 10571724, 10793063, 10938273, 14984058, 15610525, 16969099, 19123925, 19703903, 20421967, 20657552, 21239604, 24902661, 2602381, 31826047 View all (8 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	10362144, 10451481, 10571724, 10951239, 11255016, 12789289, 14534536, 15091192, 15523674, 15610525, 16969099, 19067715, 19123925, 19137261, 21147226 View all (30 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	16570276, 16835268, 16969099, 17786470, 18922915		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	19221091		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	20657552	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	20657552, 30774332	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	34219465	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	11255016, 21467165, 23370332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	CTD_human_DG	23595028		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	BEFREE	30134924		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis, Acute Fulminating	Multiple Sclerosis	CTD_human_DG	23595028		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	32157826	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	22955913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	14711179, 34565470	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	30613028, 31212255		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	24528033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	24528033	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10362144, 10451481, 10571724, 18196513, 19123925, 20884621, 21072847, 21095067, 21450088, 22051146, 22076922, 22210108, 22271434, 22610942, 22718841 View all (23 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	28553358		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	33452207	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	29941005		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	BEFREE	30928429		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28825843		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	34219465	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	10211875	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	25266708	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteochondritis Dissecans	Osteochondritis Dissecans	BEFREE	28770227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	22271434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	27823976	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	36618348	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	30274262		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	16804906		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	19123925, 22610942, 26906545, 30274262		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	19123925, 20657552, 22610942, 25510693, 31424655, 31752757	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	26373617, 27583552		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	29889530		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritoneal Neoplasms	Peritoneal Neoplasms	CTD_human_DG	22784439, 23621518		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pleural effusion disorder	Pleural effusion	BEFREE	28577209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyarteritis Nodosa	Polyarteritis Nodosa	BEFREE	30815677		★★★★★ ★☆☆☆☆ Found in Text Mining only
POLYARTERITIS NODOSA, CHILDHOOD-ONSET	Polyarteritis Nodosa	BEFREE	30815677		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	LHGDN	19029148		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11536311, 11722842, 14980717, 18196513, 19123925, 21334670, 25729916, 28147335, 30745464, 31092432, 31826047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	11722842, 18604730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	15107804, 19123925, 20657552, 24769028, 26158290, 28147335, 31958077	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	10951239	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	26748901		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	31391533, 31488850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	14516134	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	21239604	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	31776424		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	16540638, 24236063		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29541188		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor	Rhabdoid Tumor	BEFREE	27041577		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10211875, 25113810		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	21959269		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	21959269, 24681356	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	26293576	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	26517673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Endometrial Stromal	Endometrial stromal sarcoma	Pubtator	26293576	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
SCLEROSING CHOLANGITIS, NEONATAL	Sclerosing Cholangitis	BEFREE	31770615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	23738744	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	10951239	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	26748901, 30904617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	10951239	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	28646020		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylarthritis	Spondyloarthritis	BEFREE	22972410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	10951239		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	26928402		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	22754372	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	23011890	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	27726047, 31776424		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	22190201	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	22190201		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	22210108		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	28347241	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	27647179	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	21804459	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	28140525		★★★★★ ★☆☆☆☆ Found in Text Mining only

MCAM (melanoma cell adhesion molecule)