Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	4153
Gene name	Mannose binding lectin 2
Gene symbol	MBL2
Synonyms (NCBI Gene)	COLEC1HSMBPCMBLMBL2DMBPMBP-CMBP1MBPD
Chromosome	10
Chromosome location	10q21.1
Summary	This gene encodes the soluble mannose-binding lectin or mannose-binding protein found in serum. The protein encoded belongs to the collectin family and is an important element in the innate immune system. The protein recognizes and binds to mannose and N-

Show/Hide all (2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1800450	C>T	Pathogenic	Coding sequence variant, missense variant
rs5030737	G>A	Risk-factor, pathogenic	Coding sequence variant, missense variant

145

Show/Hide all (145)

miRTarBase ID	miRNA	Experiments	Reference
MIRT618888	hsa-miR-619-3p	HITS-CLIP	23824327
MIRT618887	hsa-miR-7851-3p	HITS-CLIP	23824327
MIRT618886	hsa-miR-6808-5p	HITS-CLIP	23824327
MIRT618885	hsa-miR-6893-5p	HITS-CLIP	23824327
MIRT618884	hsa-miR-940	HITS-CLIP	23824327
MIRT618883	hsa-miR-3929	HITS-CLIP	23824327
MIRT618882	hsa-miR-4419b	HITS-CLIP	23824327
MIRT618881	hsa-miR-4478	HITS-CLIP	23824327
MIRT618880	hsa-miR-4768-3p	HITS-CLIP	23824327
MIRT618879	hsa-miR-4649-3p	HITS-CLIP	23824327
MIRT618878	hsa-miR-3192-5p	HITS-CLIP	23824327
MIRT618877	hsa-miR-4635	HITS-CLIP	23824327
MIRT618876	hsa-miR-1827	HITS-CLIP	23824327
MIRT618875	hsa-miR-485-5p	HITS-CLIP	23824327
MIRT618874	hsa-miR-6884-5p	HITS-CLIP	23824327
MIRT618873	hsa-miR-4722-5p	HITS-CLIP	23824327
MIRT618872	hsa-miR-7160-5p	HITS-CLIP	23824327
MIRT618871	hsa-miR-7106-5p	HITS-CLIP	23824327
MIRT618870	hsa-miR-149-3p	HITS-CLIP	23824327
MIRT618869	hsa-miR-4728-5p	HITS-CLIP	23824327
MIRT618868	hsa-miR-6785-5p	HITS-CLIP	23824327
MIRT618867	hsa-miR-6883-5p	HITS-CLIP	23824327
MIRT618866	hsa-miR-6799-5p	HITS-CLIP	23824327
MIRT618865	hsa-miR-1273h-5p	HITS-CLIP	23824327
MIRT618864	hsa-miR-30b-3p	HITS-CLIP	23824327
MIRT618863	hsa-miR-3689a-3p	HITS-CLIP	23824327
MIRT618862	hsa-miR-3689b-3p	HITS-CLIP	23824327
MIRT618861	hsa-miR-3689c	HITS-CLIP	23824327
MIRT618860	hsa-miR-6779-5p	HITS-CLIP	23824327
MIRT618859	hsa-miR-6780a-5p	HITS-CLIP	23824327
MIRT618858	hsa-miR-665	HITS-CLIP	23824327
MIRT528284	hsa-miR-4311	PAR-CLIP	22012620
MIRT528283	hsa-miR-128-3p	PAR-CLIP	22012620
MIRT528282	hsa-miR-216a-3p	PAR-CLIP	22012620
MIRT528281	hsa-miR-3681-3p	PAR-CLIP	22012620
MIRT528280	hsa-miR-1273f	PAR-CLIP	22012620
MIRT528279	hsa-miR-4696	PAR-CLIP	22012620
MIRT528278	hsa-miR-4640-5p	PAR-CLIP	22012620
MIRT528277	hsa-miR-4726-5p	PAR-CLIP	22012620
MIRT528276	hsa-miR-6508-3p	PAR-CLIP	22012620
MIRT528275	hsa-miR-3653-3p	PAR-CLIP	22012620
MIRT528274	hsa-miR-3658	PAR-CLIP	22012620
MIRT618888	hsa-miR-619-3p	HITS-CLIP	23824327
MIRT618887	hsa-miR-7851-3p	HITS-CLIP	23824327
MIRT618886	hsa-miR-6808-5p	HITS-CLIP	23824327
MIRT618885	hsa-miR-6893-5p	HITS-CLIP	23824327
MIRT618884	hsa-miR-940	HITS-CLIP	23824327
MIRT618883	hsa-miR-3929	HITS-CLIP	23824327
MIRT618882	hsa-miR-4419b	HITS-CLIP	23824327
MIRT618881	hsa-miR-4478	HITS-CLIP	23824327
MIRT618880	hsa-miR-4768-3p	HITS-CLIP	23824327
MIRT618879	hsa-miR-4649-3p	HITS-CLIP	23824327
MIRT618878	hsa-miR-3192-5p	HITS-CLIP	23824327
MIRT618877	hsa-miR-4635	HITS-CLIP	23824327
MIRT618876	hsa-miR-1827	HITS-CLIP	23824327
MIRT618875	hsa-miR-485-5p	HITS-CLIP	23824327
MIRT618874	hsa-miR-6884-5p	HITS-CLIP	23824327
MIRT618873	hsa-miR-4722-5p	HITS-CLIP	23824327
MIRT618872	hsa-miR-7160-5p	HITS-CLIP	23824327
MIRT618871	hsa-miR-7106-5p	HITS-CLIP	23824327
MIRT618870	hsa-miR-149-3p	HITS-CLIP	23824327
MIRT618869	hsa-miR-4728-5p	HITS-CLIP	23824327
MIRT618868	hsa-miR-6785-5p	HITS-CLIP	23824327
MIRT618867	hsa-miR-6883-5p	HITS-CLIP	23824327
MIRT618866	hsa-miR-6799-5p	HITS-CLIP	23824327
MIRT618865	hsa-miR-1273h-5p	HITS-CLIP	23824327
MIRT618864	hsa-miR-30b-3p	HITS-CLIP	23824327
MIRT618863	hsa-miR-3689a-3p	HITS-CLIP	23824327
MIRT618862	hsa-miR-3689b-3p	HITS-CLIP	23824327
MIRT618861	hsa-miR-3689c	HITS-CLIP	23824327
MIRT618860	hsa-miR-6779-5p	HITS-CLIP	23824327
MIRT618859	hsa-miR-6780a-5p	HITS-CLIP	23824327
MIRT618858	hsa-miR-665	HITS-CLIP	23824327
MIRT528284	hsa-miR-4311	PAR-CLIP	22012620
MIRT528283	hsa-miR-128-3p	PAR-CLIP	22012620
MIRT528282	hsa-miR-216a-3p	PAR-CLIP	22012620
MIRT528281	hsa-miR-3681-3p	PAR-CLIP	22012620
MIRT528280	hsa-miR-1273f	PAR-CLIP	22012620
MIRT528279	hsa-miR-4696	PAR-CLIP	22012620
MIRT528278	hsa-miR-4640-5p	PAR-CLIP	22012620
MIRT528277	hsa-miR-4726-5p	PAR-CLIP	22012620
MIRT528276	hsa-miR-6508-3p	PAR-CLIP	22012620
MIRT528275	hsa-miR-3653-3p	PAR-CLIP	22012620
MIRT528274	hsa-miR-3658	PAR-CLIP	22012620
MIRT1135243	hsa-miR-1273e	CLIP-seq
MIRT1135244	hsa-miR-127-5p	CLIP-seq
MIRT1135245	hsa-miR-186	CLIP-seq
MIRT1135246	hsa-miR-302a	CLIP-seq
MIRT1135247	hsa-miR-302b	CLIP-seq
MIRT1135248	hsa-miR-302c	CLIP-seq
MIRT1135249	hsa-miR-302d	CLIP-seq
MIRT1135250	hsa-miR-302e	CLIP-seq
MIRT1135251	hsa-miR-3133	CLIP-seq
MIRT1135252	hsa-miR-3173-3p	CLIP-seq
MIRT1135253	hsa-miR-320a	CLIP-seq
MIRT1135254	hsa-miR-320b	CLIP-seq
MIRT1135255	hsa-miR-320c	CLIP-seq
MIRT1135256	hsa-miR-320d	CLIP-seq
MIRT1135257	hsa-miR-320e	CLIP-seq
MIRT1135258	hsa-miR-335	CLIP-seq
MIRT1135259	hsa-miR-3613-3p	CLIP-seq
MIRT1135260	hsa-miR-3647-3p	CLIP-seq
MIRT1135261	hsa-miR-3653	CLIP-seq
MIRT1135262	hsa-miR-372	CLIP-seq
MIRT1135263	hsa-miR-373	CLIP-seq
MIRT1135264	hsa-miR-4266	CLIP-seq
MIRT1135265	hsa-miR-4429	CLIP-seq
MIRT1135266	hsa-miR-4508	CLIP-seq
MIRT1135267	hsa-miR-4653-3p	CLIP-seq
MIRT1135268	hsa-miR-4695-5p	CLIP-seq
MIRT1135269	hsa-miR-4719	CLIP-seq
MIRT1135270	hsa-miR-4779	CLIP-seq
MIRT1135271	hsa-miR-4786-3p	CLIP-seq
MIRT1135272	hsa-miR-513b	CLIP-seq
MIRT1135273	hsa-miR-515-3p	CLIP-seq
MIRT1135274	hsa-miR-519a	CLIP-seq
MIRT1135275	hsa-miR-519b-3p	CLIP-seq
MIRT1135276	hsa-miR-519c-3p	CLIP-seq
MIRT1135277	hsa-miR-519e	CLIP-seq
MIRT1135278	hsa-miR-520a-3p	CLIP-seq
MIRT1135279	hsa-miR-520b	CLIP-seq
MIRT1135280	hsa-miR-520c-3p	CLIP-seq
MIRT1135281	hsa-miR-520d-3p	CLIP-seq
MIRT1135282	hsa-miR-520e	CLIP-seq
MIRT1135283	hsa-miR-671-5p	CLIP-seq
MIRT1135284	hsa-miR-765	CLIP-seq
MIRT2038438	hsa-miR-1290	CLIP-seq
MIRT1135269	hsa-miR-4719	CLIP-seq
MIRT1135272	hsa-miR-513b	CLIP-seq
MIRT2038439	hsa-miR-580	CLIP-seq
MIRT2268286	hsa-miR-1207-3p	CLIP-seq
MIRT2268287	hsa-miR-1283	CLIP-seq
MIRT2268288	hsa-miR-3125	CLIP-seq
MIRT2268289	hsa-miR-3916	CLIP-seq
MIRT2268290	hsa-miR-4668-3p	CLIP-seq
MIRT2268291	hsa-miR-4694-3p	CLIP-seq
MIRT2268292	hsa-miR-520a-5p	CLIP-seq
MIRT2268293	hsa-miR-525-5p	CLIP-seq
MIRT2268294	hsa-miR-936	CLIP-seq
MIRT2453800	hsa-miR-3121-3p	CLIP-seq
MIRT2453801	hsa-miR-3123	CLIP-seq
MIRT2453802	hsa-miR-3925-5p	CLIP-seq
MIRT2453803	hsa-miR-3976	CLIP-seq
MIRT2453804	hsa-miR-520d-5p	CLIP-seq
MIRT2453805	hsa-miR-524-5p	CLIP-seq

Show/Hide all (53)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001867	Process	Complement activation, lectin pathway	IDA	15148336, 18204047, 23386610
GO:0001867	Process	Complement activation, lectin pathway	IDA	9087411, 22691502, 35102342
GO:0001867	Process	Complement activation, lectin pathway	IEA
GO:0001867	Process	Complement activation, lectin pathway	IEA
GO:0001867	Process	Complement activation, lectin pathway	IPI	11549596
GO:0001905	Process	Activation of membrane attack complex	IDA	18204047
GO:0002376	Process	Immune system process	IEA
GO:0002752	Process	Cell surface pattern recognition receptor signaling pathway	IDA	22966085
GO:0005102	Function	Signaling receptor binding	IPI	11549596
GO:0005515	Function	Protein binding	IPI	11290788, 11485744, 15117939, 18177377, 19939495, 20956340, 21035894, 21054788, 21106539, 21203938, 21268013, 21383675, 22607836, 22811680, 22854970, 23460739, 25579818, 27104295, 27141819, 29563915, 32041782, 32296183, 32759297, 33961781, 35102342
GO:0005537	Function	D-mannose binding	IDA	6643429, 23544079
GO:0005537	Function	D-mannose binding	IEA
GO:0005537	Function	D-mannose binding	NAS	11549596
GO:0005537	Function	D-mannose binding	TAS	2477488
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005581	Component	Collagen trimer	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	23544079
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	NAS	25579818
GO:0005615	Component	Extracellular space	TAS	1304173
GO:0005771	Component	Multivesicular body	IBA
GO:0006508	Process	Proteolysis	IDA	22691502
GO:0006953	Process	Acute-phase response	TAS	2477488
GO:0006956	Process	Complement activation	IDA	26841934, 30111885, 37852260
GO:0006958	Process	Complement activation, classical pathway	IEA
GO:0006979	Process	Response to oxidative stress	NAS	11549596
GO:0008228	Process	Opsonization	IDA	3897448, 8538770
GO:0008228	Process	Opsonization	TAS	2477488
GO:0009897	Component	External side of plasma membrane	NAS	22966085
GO:0009986	Component	Cell surface	TAS	2477488
GO:0030246	Function	Carbohydrate binding	IEA
GO:0031638	Process	Zymogen activation	IDA	22691502, 23386610
GO:0031640	Process	Killing of cells of another organism	IDA	30552328
GO:0038187	Function	Pattern recognition receptor activity	IDA	9087411
GO:0042742	Process	Defense response to bacterium	TAS	2477488
GO:0042802	Function	Identical protein binding	IPI	21106539, 21383675, 22607836, 25579818, 27104295
GO:0043129	Process	Surfactant homeostasis	IBA
GO:0045087	Process	Innate immune response	IDA	23544079
GO:0045087	Process	Innate immune response	IEA
GO:0048306	Function	Calcium-dependent protein binding	IPI	12421953, 18596036, 35102342
GO:0048525	Process	Negative regulation of viral process	IDA	23544079
GO:0050766	Process	Positive regulation of phagocytosis	IBA
GO:0050766	Process	Positive regulation of phagocytosis	IEA
GO:0050830	Process	Defense response to Gram-positive bacterium	IDA	15148336
GO:0050830	Process	Defense response to Gram-positive bacterium	IEA
GO:0051604	Process	Protein maturation	IDA	6906228, 18204047, 22691502
GO:0051873	Process	Killing by host of symbiont cells	IEA
GO:0106139	Component	Symbiont cell surface	IDA	2573758, 8082295, 22966085
GO:0140374	Process	Antiviral innate immune response	IDA	35102342
GO:1903028	Process	Positive regulation of opsonization	IDA	22966085
GO:1905370	Component	Serine-type endopeptidase complex	IPI	25579818

MIM	HGNC	e!Ensembl
154545	6922	ENSG00000165471

P11226

Protein name

Mannose-binding protein C (MBP-C) (Collectin-1) (MBP1) (Mannan-binding protein) (Mannose-binding lectin)

Protein function

Calcium-dependent lectin involved in innate immune defense (PubMed:35102342). Binds mannose, fucose and N-acetylglucosamine on different microorganisms and activates the lectin complement pathway. Binds to late apoptotic cells, as well as to apo

PDB

1HUP

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01391	Collagen	40 → 104	Collagen triple helix repeat (20 copies)	Repeat
PF00059	Lectin_C	144 → 246	Lectin C-type domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Plasma protein produced mainly in the liver. {ECO:0000269|PubMed:18006063}.

Sequence

MSLFPSLPLLLLSMVAASYSETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKG
EPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMA
RIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKE
EAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSH
LAVCEFPI

Sequence length

248

Interactions

View interactions

	KEGG		Reactome
	Phagosome Complement and coagulation cascades Staphylococcus aureus infection Coronavirus disease - COVID-19		Lectin pathway of complement activation Initial triggering of complement

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (55)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMERS DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AORTIC VALVE INSUFFICIENCY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTERIAL OCCLUSIVE DISEASES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE THYROIDITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BEHCET SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR I DISORDER, MOST RECENT EPISODE MANIC	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRONCHIOLITIS OBLITERANS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRONCHOPULMONARY DYSPLASIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBRAL CRYPTOCOCCOSES, GRANULOMOUS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBRAL CRYPTOCOCCOSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE AIRWAY DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CILIARY DYSKINESIA, PRIMARY, 1, WITH OR WITHOUT SITUS INVERSUS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMMON VARIABLE IMMUNODEFICIENCY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY RESTENOSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHNS DISEASE OF LARGE BOWEL	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CRYPTOSPORIDIOSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cystic fibrosis	Conflicting classifications of pathogenicity	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
DEPRESSION, BIPOLAR	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ATOPIC	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATOMYOSITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES, GESTATIONAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GESTATIONAL DIABETES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GIANT CELL ARTERITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLAUCOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMOLYTIC-UREMIC SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS B	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS C	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, CHRONIC	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEISHMANIASIS, VISCERAL	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEPROSY, LEPROMATOUS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER DISEASES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUPUS ERYTHEMATOSUS, SYSTEMIC	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUPUS NEPHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mannose-binding lectin deficiency	Uncertain significance; Conflicting classifications of pathogenicity; Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MBL2-related disorder	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIXED BIPOLAR I DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MUCOCUTANEOUS LYMPH NODE SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-NEOPLASTIC PERIPHERAL NERVOUS SYSTEM DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANIC DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL NERVOUS SYSTEM DISEASES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL NEUROPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYMYALGIA RHEUMATICA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYNESIAN BRONCHIECTASIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY FIBROSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATIC AORTIC REGURGITATION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHINITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SENSORINEURAL HEARING LOSS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THROMBOCYTOPENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOXIC SHOCK SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VITILIGO	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (418)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
AA amyloidosis	AA amyloidosis	BEFREE	17875183		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acquired Hypogammaglobulinemia	Common Variable Immunodeficiency	BEFREE	10652157, 19408100, 19851769		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	19711212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	24819208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	12393405		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute otitis media	Otitis media	BEFREE	28403045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	18288881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	12393405		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	12485445, 24103065		★★★★★ ★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	17266113, 26207622, 27605007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	BEFREE	26079505		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agranulocytosis	Agranulocytosis	BEFREE	18637104		★★★★★ ★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	16487239		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	17875183		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	LHGDN	17875183		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	Pubtator	17875183	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	12933871		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	LHGDN	18396436		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	11872237, 18494378, 20172753, 20504205, 24753481, 28837214		★★★★★ ★☆☆☆☆ Found in Text Mining only
Angina, Unstable	Intermediate coronary syndrome	BEFREE	19711212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Angioedemas Hereditary	Angioedema	Pubtator	18250972	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Angioedemas, Hereditary	Angioedema	BEFREE	16026838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	LHGDN	17896801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	21544638, 28879439		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anthracosis	Anthracosis	BEFREE	18496832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anthracosis	Anthracosis	LHGDN	18496832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid Syndrome	BEFREE	16801331		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	18400978		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aortic Valve Insufficiency	Aortic valve disease	Pubtator	18400978	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arteriosclerosis	Arteriosclerosis	BEFREE	10822900, 12196331, 15254284, 15295097, 15790942, 17439930, 19380618, 19939454, 20595266, 24255984, 28056798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	18334024, 18602696, 25070856, 29324290, 31214191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	18334024	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10728743, 17195187, 17875183, 18052966, 21496252, 26686423, 28898115	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10943857, 24751721	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	20068595		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthropathy	Arthropathy	BEFREE	24264011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	14564351, 16178865, 16487239, 17014624, 17651383, 17845414, 18729778, 20298391, 22674410, 27590640, 31157540		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	LHGDN	15853952		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	16178865, 16487239, 22441636, 22674410, 35818159	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma Occupational	Asthma	Pubtator	25857450	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma, Occupational	Asthma	BEFREE	25857450		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	10822900, 12196331, 15254284, 15295097, 15790942, 17439930, 19380618, 19939454, 20595266, 24255984, 28056798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	12196331, 15254284, 19161617, 20833838, 22848725, 28056798	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	32389013	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	10071515, 10652157, 11196679, 12485445, 14764589, 15645196, 16081027, 16186405, 16220211, 16380821, 16681863, 16720204, 16738667, 17014624, 17337399 View all (21 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	10652157, 16681863, 17286761, 24751721, 26564804, 9854050	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	LHGDN	15645196		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune hemolytic anemia	Autoimmune hemolytic anemia	BEFREE	23000377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	LHGDN	12918709		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Behcet Syndrome	Behcet Syndrome	BEFREE	15730518, 19796526, 28706259		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Behcet Syndrome	Behcet disease	Pubtator	28706259	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	BEFREE	24856568		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	24856568		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	34663707	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	32871607	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	18552214	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	BEFREE	30967639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	17071626, 19934312, 20412594, 20886042, 23421821, 25783214, 27940354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	BEFREE	15681508, 18637104, 19851769, 22225939, 24429128, 30970022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	Pubtator	18637104	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	BEFREE	22441636		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	Pubtator	22441636	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchiolitis Obliterans	Bronchiolitis Obliterans	BEFREE	25939617		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchitis	Bronchitis	BEFREE	28686880		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	17898783, 21681178		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchopulmonary Dysplasia	Bronchopulmonary dysplasia	Pubtator	18637104	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
C3 Glomerulonephritis	C3 Glomerulonephritis	BEFREE	31014550		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	23250731	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	25787238, 26414287, 27557564, 27824315, 31046434, 32443377	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma in situ of uterine cervix	Cervical Intraepithelial Neoplasia	BEFREE	29131134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	17178888, 17848669, 19959685, 25783214		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	22633170	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	22927777, 29775825, 30526728		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	30526728	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	38167099	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	20886042		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Abnormalities	Cardiovascular Abnormalities	BEFREE	12699957		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	15161763, 15790942, 16801331, 19939454, 20110521, 24861434, 25783214, 27055907, 30629683, 31220397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	17846289, 26516624	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	LHGDN	19161617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carditis	Carditis	BEFREE	18602696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Artery Thrombosis	Carotid artery thrombosis	Pubtator	15254284	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	15790942		★★★★★ ★☆☆☆☆ Found in Text Mining only
CATARACT, ANTERIOR POLAR	Cataract	BEFREE	18582923, 18641104		★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	12439623, 15645196		★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	LHGDN	12439623, 15645196, 18478332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Central Diabetes Insipidus	Diabetes Insipidus	BEFREE	25170052		★★★★★ ★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Central nervous system disease	Pubtator	18602571	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	20140243, 22879370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	BEFREE	16522396, 18455525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	LHGDN	18455525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	20140243, 29864785		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	19275921, 19371855, 27619685		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	19275921, 19371855, 27619685		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chagas Cardiomyopathy	Chagas Cardiomyopathy	BEFREE	29775825		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chagas Disease	Chagas disease	Pubtator	22302853, 26745156, 30526728	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	12393405		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	14564351		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	25281004, 29514287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	22168404, 23999128, 27469216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	12761563, 19836222, 20298391, 26684757		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	LHGDN	12761563		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Periodontitis	Periodontitis	Pubtator	19252378	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	20132924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	10094971, 11333866, 16231358, 27298104		★★★★★ ★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	18415846		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	23662819	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	26442658		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	21088049	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	22282660		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	10328552	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	21198752, 22282660, 9892640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21198752, 22282660	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common Variable Immunodeficiency	BEFREE	10652157, 18637104, 19408100, 19851769		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	10652157, 18637104	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMPLEMENT COMPONENT 2 DEFICIENCY	Complement Component Deficiency	BEFREE	16785571, 17335556		★★★★★ ★☆☆☆☆ Found in Text Mining only
Complement Component 3 Deficiency Autosomal Recessive	Complement component deficiency	Pubtator	23841802	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	24116040		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital sensorineural hearing loss	Congenital Sensorineural Hearing Loss	BEFREE	23246423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conjunctivitis	Conjunctivitis	BEFREE	28408304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Coronary Aneurysm	BEFREE	15295097		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Coronary aneurysm	Pubtator	29207079	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	12196331, 21211797, 25482922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	12196331, 14732744, 21211797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	12196331, 16385529, 29207079	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	12196331, 21211797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Restenosis	Coronary restenosis	Pubtator	28056798	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Critical Illness	Critical illness	Pubtator	27820718, 31139182, 32871607	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	11607788, 15480986, 17480019, 17921115, 20079790, 20182871, 20824817, 21702710, 27404661, 31703823		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	LHGDN	17303612, 17480019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	27404661	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Disease Of Lung	Cystic lung disease	Pubtator	15654829	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	10449435, 10866448, 11333866, 11836800, 12124743, 12473150, 15516675, 15654829, 16046196, 16263483, 16429424, 17045845, 17158822, 18292811, 18637104 View all (8 more)		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Cystic Fibrosis	Cystic fibrosis	Pubtator	10449435, 11333866, 15516675, 15654829, 16046196, 17158822, 18292811, 18292812, 18637104, 19738092, 20068595, 25178872, 33679736, 35748244	Associate	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Cystic Fibrosis	Cystic Fibrosis	CLINVAR_DG			★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Cystitis	Cystitis	BEFREE	28408304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dental Caries	Dental caries	Pubtator	28937897	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	31260126		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	26124183, 36994777	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic 1	Atopic dermatitis	Pubtator	18831943	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	LHGDN	18347304		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Atopic	Dermatitis	BEFREE	20642202		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatomyositis	Dermatomyositis	BEFREE	12485445, 24103065		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatomyositis	Dermatomyositis	Pubtator	12485445, 15982317	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Developmental absence of tooth	Anodontia	BEFREE	30088554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	15161763, 20522590, 20693349, 23350935, 26136138, 28318015, 28349070, 28751823, 29961608		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Complications	Diabetes complications	Pubtator	36618347	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	20522590	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	15161763, 20522590, 20693349, 23350935, 26136138, 28318015, 28349070, 28751823, 29961608, 31338070		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	19517215, 20522590, 20693349, 26136138, 35748244	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	19366862, 19517215, 20522590, 26768002, 36618347	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	20522590, 20693349, 24376633, 26136138, 36618347	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	12770793, 15161763, 16186405, 17869647, 18361935, 19185543, 19366862, 19517215, 20522590, 23350935, 26180106, 26768002, 28751823, 29318157, 30836628		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	20522590, 23602874, 24376633, 26136138, 26180106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes, Autoimmune	Autoimmune Diabetes	BEFREE	31117958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic angiopathies	Pubtator	19517215	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	19366862, 26768002	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	15161763, 16720204, 19366862, 23350935, 24376633, 26768002, 28349070, 29318157, 29604259, 29729954, 31338070		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	26136138, 29961608		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	26136138	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diarrhea	Diarrhea	Pubtator	34583337	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse panbronchiolitis	Diffuse Panbronchiolitis	BEFREE	15249448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Disseminated Intravascular Coagulation	Disseminated Intravascular Coagulation	BEFREE	19793001, 22114968, 30808212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	17314117, 18082567, 18727690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	20642202		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	30698832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	29572748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	39892863	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Enterocolitis Necrotizing	Enterocolitis	Pubtator	31029683	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	16114131, 16487239		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	Pubtator	16487239	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	25431829	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	18336595, 20570631, 28783370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gangrene	Gangrene	BEFREE	28097447		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	16476012	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	19352197		★★★★★ ★☆☆☆☆ Found in Text Mining only
Genital ulcers	Genital ulcers	BEFREE	19796526		★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	12375325		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	22335808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	23637788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	23637788	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	Pubtator	37713183	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	25973081, 30967869, 37065697	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	27153925, 31138153	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	29330473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	16982337	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	16982337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Granulomatous Disease Chronic	Granulomatous disease	Pubtator	9854050	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	20356797, 22360648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome	Guillain-Barre Syndrome	BEFREE	16951387		★★★★★ ★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome	Guillain-Barre Syndrome	LHGDN	16951387		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	17480019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	20356797, 22360648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	27982280, 30629683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	29653582	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	30526728	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
HELLP Syndrome	HELLP Syndrome	BEFREE	17314117		★★★★★ ★☆☆☆☆ Found in Text Mining only
HELLP Syndrome	HELLP Syndrome	LHGDN	17314117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	15674393		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	24886325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	25281004	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia	BEFREE	31141731		★★★★★ ★☆☆☆☆ Found in Text Mining only
Henoch-Schoenlein Purpura	Henoch-Schonlein Nephritis	BEFREE	24576294		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	27557564, 27824315	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatitis B	Hepatitis b	Pubtator	33643280	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatitis C Chronic	Hepatitis c	Pubtator	18336595, 31962161	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Hereditary Pancreatitis	BEFREE	19716183		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	21974696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	21974696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	25482922, 28349070, 28751823		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	23107763		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Hypersensitivity	Pubtator	18498240	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	LHGDN	17439930, 18091754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	21895981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	BEFREE	20356797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	20356797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	20412594	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Membranous Glomerulonephritis	Membranous Glomerulonephritis	BEFREE	27153925		★★★★★ ★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	11274270, 25973081, 28698271, 30141239		★★★★★ ★☆☆☆☆ Found in Text Mining only
IgG Deficiency disorder	IgG Deficiency Disorder	BEFREE	17110469, 31117958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	17845414, 19056797, 19185543, 22377282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	21591983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunoglobulin A deficiency (disorder)	Immunoglobulin A deficiency	BEFREE	17110469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	10447262, 20887383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	11607788, 20079790, 20182871, 21088049, 21702710, 31703823		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	21088049	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	31260126		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	20522590	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	LHGDN	18478332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	31495300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	16681863, 19286845		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile polyposis syndrome	Polyposis Syndrome	BEFREE	22994203, 25747542		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile psoriatic arthritis	Juvenile arthritis	BEFREE	18334024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	30482213, 30606111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kartagener Syndrome	Kartagener Syndrome	BEFREE	24753481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratitis	Keratitis	Pubtator	24426774	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	15161763, 19366862, 21532056, 27820718		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	27820718	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	26768002		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	30967869	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	21835783		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	25281004, 29514287		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leprosy	Leprosy	BEFREE	17922403, 20650301, 23423485, 23935922, 29627640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	20650301, 21640628, 33013845	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leprosy Lepromatous	Leprosy	Pubtator	20650301	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	23999128		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	20331735		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	14614673, 16494622, 20331735		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	16231358, 18221301, 21733090, 24116040, 25787238, 26414287, 27298104, 27557564, 30713782, 30747617, 30798068, 31046434, 31830994		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	16231358		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	10094971, 11333866, 16231358, 19540295, 24116040, 27298104		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis	Liver cirrhosis	Pubtator	18336595	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	10728743	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	11333866, 19738092	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Failure	Liver failure	Pubtator	18336595, 31962161	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	30747617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	10449435, 11836800, 15654829, 16263483, 21045008, 22131319, 29703608		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	10449435, 34570692, 37313996	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	LHGDN	17653692, 18292811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	33101280	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases, Obstructive	Lung Diseases	BEFREE	20298391		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	17178888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	17848669, 19959685	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus anticoagulant disorder	Lupus anticoagulant	BEFREE	31134052		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	17509159, 17552055, 24798938, 28097447		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	10524686, 15147364, 15254284, 15535834, 15647440, 16439442, 17166254, 17335556, 19035512, 25900955, 26686423, 32111865	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	12485445, 17509159, 17552055, 24798938, 28097447		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	10524686, 11196679, 11393663, 11561111, 11781711, 12648279, 12672193, 15147364, 15254284, 15479757, 15647440, 16320344, 16439442, 16729310, 16801331 View all (31 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	16320344, 17552055, 17610319, 18214570, 19035512		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Nephritis	Lupus Nephritis	BEFREE	24798938		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Vulgaris	Lupus Vulgaris	BEFREE	17509159, 17552055, 28097447		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	23250731	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	30294330		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	19557622		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	25897830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	26207622	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	17071626, 19934312, 20412594, 20886042, 23421821, 25783214, 27940354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	30698832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	27824315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	17178888, 17848669, 19959685, 25783214		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	16762917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	16721783, 18368489, 31767616		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	1672848, 23250731		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11530147, 15159056, 17071626, 19275921, 19934312, 21488869, 21557458, 23062612, 23073041, 26433879, 28393357, 28472687, 30713782, 31052260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	19275921, 19371855, 27619685		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	22282660		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	17071626		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mannose-Binding Protein Deficiency	Mannose-Binding Protein Deficiency	CLINVAR_DG	10071515, 22323042, 7707811, 8206524		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mannose-Binding Protein Deficiency	Mannose-Binding Protein Deficiency	BEFREE	10075024, 10469715, 11054381, 11836800, 11891230, 15480986, 15838797, 16023210, 16081027, 16133991, 16277709, 16500704, 17002903, 17133182, 18334024 View all (42 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mannose-Binding Protein Deficiency	Mannose-Binding Protein Deficiency	GENOMICS_ENGLAND_DG	28347655		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mannose-Binding Protein Deficiency	Mannose-Binding Protein Deficiency	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
MASP2 Deficiency	MASP2 Deficiency	BEFREE	16982337, 17045845, 19767106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Membranous glomerulonephritis	Membranous Glomerulonephritis	BEFREE	27153925, 29439276, 29769410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	10075024, 10469715, 11737072, 18927129, 28898115		★★★★★ ★☆☆☆☆ Found in Text Mining only
Monoclonal B-Cell Lymphocytosis	B-Cell Lymphocytosis	BEFREE	12472676, 16720204, 27469216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	12699957, 15295097, 16385529, 20374367		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	LHGDN	15295097		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	16385529, 20374367, 29207079	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Endocrine Neoplasia Type 2a	Multiple Endocrine Neoplasia	BEFREE	1672848		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	16827883, 16953214, 28805791, 30294330		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	17875183	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	17113160, 26732593		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	21911261	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy	Muscular dystrophy	BEFREE	18430716		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	18430716		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	12196331, 17195187, 17846289, 20693349, 22848725	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	17195187, 20693349, 22848725, 25783214		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	LHGDN	17846289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	32389013	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	17195187, 20110521, 25482922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial ischemia	Pubtator	17195187	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	19301063		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	BEFREE	29324290		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	22301105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	23576520	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrotizing Enterocolitis	Necrotizing Enterocolitis	BEFREE	20453525, 22331020, 28246614		★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	20453525, 22331020, 28246614, 31029683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10380882, 16359544, 17131120, 20412594, 23250731, 23975832, 24684412, 25474134, 25543836, 25897830, 30713782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	21510992, 24850777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	14614673, 16494622, 20331735		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	Pubtator	19657091, 20930093	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	17178888, 17848669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	16955210, 25008177, 27059147		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	26694100	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Optic Neuropathy Ischemic	Optic neuropathy	Pubtator	19439017	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	27357723, 27669725, 28325134, 29843053, 30028553, 30088554, 31576952		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	24579967		★★★★★ ★☆☆☆☆ Found in Text Mining only
Otitis Media	Otitis media	BEFREE	10528874, 16750996, 22444663, 29119939, 8403525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Otitis Media	Otitis media	LHGDN	16006058, 16750996		★★★★★ ★☆☆☆☆ Found in Text Mining only
Otitis Media with Effusion	Otitis media	BEFREE	15742161		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Cysts	Ovarian cysts	Pubtator	17131120	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	17131120, 22633170, 25038892	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	16762917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	20587030	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	LHGDN	18288881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	BEFREE	24856568		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	20453525, 30480800, 31578522		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	BEFREE	21327568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	31749165		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	18823346, 27633527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	19252378	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	CTD_human_DG	20864405		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polyarthritis	Polyarthritis	BEFREE	11361219, 18334024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyendocrinopathies, Autoimmune	Autoimmune Polyendocrinopathy	BEFREE	16801331		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pre B-cell acute lymphoblastic leukemia	B-cell Lymphoma	BEFREE	24453114		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	24453114		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	12393405		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	11712863		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Ciliary Dyskinesia	Ciliary dyskinesia	BEFREE	24753481, 31012247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	16762917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	15705866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	25599785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	23113841, 31260126		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Cystic Fibrosis	Pulmonary Cystic Fibrosis	BEFREE	11836800, 19467940		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	24901869, 26684757	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Reactive systemic amyloidosis	Reactive Systemic Amyloidosis	BEFREE	17875183		★★★★★ ★☆☆☆☆ Found in Text Mining only
Recurrent otitis media	Otitis media	BEFREE	15742161		★★★★★ ★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	18562462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carnitine transport defect	Renal Carnitine Transport Defect	BEFREE	24753481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	15086395		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome	Respiratory Distress Syndrome	BEFREE	31029683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	17133182, 31029683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Newborn	Congenital alveolar dysplasia	BEFREE	25879044, 31029683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Failure	Respiratory Failure	BEFREE	18637104		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory Tract Diseases	BEFREE	15086395		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory system infectious disease	Pubtator	15086395, 25879044	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	18847375, 22441636, 22444663, 24593307	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatic Heart Disease	Rheumatic Heart Disease	BEFREE	17174748, 18602696, 19802690, 28576308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatic Heart Disease	Rheumatic heart disease	Pubtator	20646009	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatic Heart Disease	Rheumatic heart disease	Pubtator	29653582	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10648014, 10728743, 10943857, 11196679, 11361219, 11393663, 11891230, 12473150, 14994386, 16220211, 17195187, 17610322, 17875183, 18052966, 18348874 View all (17 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	16220211, 17610322, 18348874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhinitis	Rhinitis	LHGDN	18831943		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rhinitis Allergic	Rhinitis	Pubtator	16487239	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	10849025		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	34663707	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	17064281, 17133182, 17711490, 19430499, 20528471, 27820718, 28558032, 31139182	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	14593599, 15127191, 15753758, 16133991, 16369192, 16827883, 16953214, 17064281, 17133182, 17711490, 18031556, 18582923, 18611155, 19430499, 19891773 View all (15 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Acute Respiratory Syndrome	Severe Acute Respiratory Syndrome	BEFREE	15838797, 15950449, 16185324, 19405982, 20573835, 25818534		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	11302870, 26686423	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	19796526, 21327568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small vessel vasculitis	Small vessel vasculitis	BEFREE	17478467		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylarthritis	Spondyloarthritis	BEFREE	27911110		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	16395704		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	16721783, 18368489, 31767616		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	16721783, 18368489		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	25952687	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomatitis	Stomatitis	BEFREE	28558032		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomatitis	Stomatitis	Pubtator	28558032	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomatitis Aphthous	Aphthous stomatitis	Pubtator	34907799	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	26516624	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	30885245		★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	30277131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	BEFREE	26088544		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	32871607	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	23250731	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	1672848, 23250731		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	20356797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid disease	Pubtator	24339961	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	1672848, 23250731		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	23250731	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	24339961	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	40545963	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Turner Syndrome	Turner Syndrome	BEFREE	30508004		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	11607788, 15480986, 20079790, 20182871, 20824817, 21088049, 21498716, 21702710, 31337064		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uremia	Uremia	BEFREE	25281004		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Tract Infections	Urinary tract infection	Pubtator	28558032	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cancer	Endometrial Cancer	BEFREE	18486762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	BEFREE	27911110		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vaginitis	Vaginitis	BEFREE	21510780		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	26768002		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	33221483	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	21729275, 26768002	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	16801331		★★★★★ ★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	40371468	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Venous Thrombosis	Venous thrombosis	Pubtator	40371468	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	17337399, 19416237		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	17337399, 19416237		★★★★★ ★☆☆☆☆ Found in Text Mining only

MBL2 (mannose binding lectin 2)