Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	414236
Gene name	Chromosome 10 putative open reading frame 55
Gene symbol	C10orf55
Synonyms (NCBI Gene)	-
Chromosome	10
Chromosome location	10q22.2

93 Show/Hide all (93)

miRTarBase ID	miRNA	Experiments	Reference
MIRT487061	hsa-miR-6873-5p	PAR-CLIP	23592263
MIRT487060	hsa-miR-1321	PAR-CLIP	23592263
MIRT487059	hsa-miR-4739	PAR-CLIP	23592263
MIRT487058	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT487057	hsa-miR-6784-5p	PAR-CLIP	23592263
MIRT487056	hsa-miR-6746-5p	PAR-CLIP	23592263
MIRT487054	hsa-miR-4419a	PAR-CLIP	23592263
MIRT487055	hsa-miR-4510	PAR-CLIP	23592263
MIRT487053	hsa-miR-6127	PAR-CLIP	23592263
MIRT487052	hsa-miR-6129	PAR-CLIP	23592263
MIRT487051	hsa-miR-6130	PAR-CLIP	23592263
MIRT487050	hsa-miR-6133	PAR-CLIP	23592263
MIRT487049	hsa-miR-3184-5p	PAR-CLIP	23592263
MIRT487048	hsa-miR-423-5p	PAR-CLIP	23592263
MIRT487046	hsa-miR-3195	PAR-CLIP	23592263
MIRT487047	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT487045	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT487044	hsa-miR-4467	PAR-CLIP	23592263
MIRT487043	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT487042	hsa-miR-8085	PAR-CLIP	23592263
MIRT487041	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT487040	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT487039	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT487038	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT487037	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT487036	hsa-miR-3180	PAR-CLIP	23592263
MIRT487035	hsa-miR-3180-3p	PAR-CLIP	23592263
MIRT487034	hsa-miR-3196	PAR-CLIP	23592263
MIRT487033	hsa-miR-6816-5p	PAR-CLIP	23592263
MIRT487061	hsa-miR-6873-5p	PAR-CLIP	23592263
MIRT487060	hsa-miR-1321	PAR-CLIP	23592263
MIRT487059	hsa-miR-4739	PAR-CLIP	23592263
MIRT487058	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT487057	hsa-miR-6784-5p	PAR-CLIP	23592263
MIRT487056	hsa-miR-6746-5p	PAR-CLIP	23592263
MIRT487054	hsa-miR-4419a	PAR-CLIP	23592263
MIRT487055	hsa-miR-4510	PAR-CLIP	23592263
MIRT487053	hsa-miR-6127	PAR-CLIP	23592263
MIRT487052	hsa-miR-6129	PAR-CLIP	23592263
MIRT487051	hsa-miR-6130	PAR-CLIP	23592263
MIRT487050	hsa-miR-6133	PAR-CLIP	23592263
MIRT487049	hsa-miR-3184-5p	PAR-CLIP	23592263
MIRT487048	hsa-miR-423-5p	PAR-CLIP	23592263
MIRT487046	hsa-miR-3195	PAR-CLIP	23592263
MIRT487047	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT487045	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT487044	hsa-miR-4467	PAR-CLIP	23592263
MIRT487043	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT487042	hsa-miR-8085	PAR-CLIP	23592263
MIRT487041	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT487040	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT487039	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT487038	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT487037	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT487036	hsa-miR-3180	PAR-CLIP	23592263
MIRT487035	hsa-miR-3180-3p	PAR-CLIP	23592263
MIRT487034	hsa-miR-3196	PAR-CLIP	23592263
MIRT487033	hsa-miR-6816-5p	PAR-CLIP	23592263
MIRT828939	hsa-miR-1207-3p	CLIP-seq
MIRT828940	hsa-miR-1270	CLIP-seq
MIRT828941	hsa-miR-27a	CLIP-seq
MIRT828942	hsa-miR-27b	CLIP-seq
MIRT828943	hsa-miR-3135b	CLIP-seq
MIRT828944	hsa-miR-361-3p	CLIP-seq
MIRT828945	hsa-miR-3679-3p	CLIP-seq
MIRT828946	hsa-miR-4683	CLIP-seq
MIRT828947	hsa-miR-513a-5p	CLIP-seq
MIRT828948	hsa-miR-620	CLIP-seq
MIRT1945410	hsa-miR-3200-5p	CLIP-seq
MIRT1945411	hsa-miR-4427	CLIP-seq
MIRT1945412	hsa-miR-4680-3p	CLIP-seq
MIRT2183799	hsa-miR-4707-5p	CLIP-seq
MIRT2435831	hsa-miR-378g	CLIP-seq
MIRT2435832	hsa-miR-4292	CLIP-seq
MIRT2435833	hsa-miR-4308	CLIP-seq
MIRT2435834	hsa-miR-4437	CLIP-seq
MIRT2435835	hsa-miR-4674	CLIP-seq
MIRT2183799	hsa-miR-4707-5p	CLIP-seq
MIRT2435831	hsa-miR-378g	CLIP-seq
MIRT2435832	hsa-miR-4292	CLIP-seq
MIRT2435833	hsa-miR-4308	CLIP-seq
MIRT2435834	hsa-miR-4437	CLIP-seq
MIRT2435835	hsa-miR-4674	CLIP-seq
MIRT2183799	hsa-miR-4707-5p	CLIP-seq
MIRT828939	hsa-miR-1207-3p	CLIP-seq
MIRT828941	hsa-miR-27a	CLIP-seq
MIRT828942	hsa-miR-27b	CLIP-seq
MIRT828947	hsa-miR-513a-5p	CLIP-seq
MIRT828939	hsa-miR-1207-3p	CLIP-seq
MIRT828941	hsa-miR-27a	CLIP-seq
MIRT828942	hsa-miR-27b	CLIP-seq
MIRT2676289	hsa-miR-4734	CLIP-seq
MIRT828947	hsa-miR-513a-5p	CLIP-seq

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	28514442, 32296183, 33961781
GO:0042802	Function	Identical protein binding	IPI	32296183

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Protein Protein information from UniProt database. Download as csv Download as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.	Q5SWW7
Protein name	Uncharacterized protein C10orf55
Family and domains
Sequence	MFLHLDSHSSLERTKPTVVGVDTHMELDEVHCCPGRDSGGGFIKGPMLQGLQGEGKLAPI PKPTLPSPSRLTLFVSSSQMEDHGFPARRNGLTQASFIYQMPAGWGSPGGLFLPCQPVPT PVVLKPPLPPCPISWGESGPAVDGIRRTPAP
Sequence length	151
Interactions	View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
C10orf55-related disorder	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (6)
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	36845013	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	GWASCAT_DG	28067908		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	GWASCAT_DG	23128233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	GWASDB_DG	23128233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Quebec platelet disorder	Quebec Platelet Disorder	BEFREE	28301587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Venous Thrombosis	Venous thrombosis	Pubtator	29334895	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Genes Genes most often co-reported with C10orf55 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for C10orf55.

Diseases Linked via Similar Genes Diseases curated for genes most similar to C10orf55 (see Related Genes above), that are NOT already directly curated for C10orf55 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to C10orf55.

C10orf55 (chromosome 10 putative open reading frame 55)

Bookmark This Gene