MAS1 (MAS1 proto-oncogene, G protein-coupled receptor)

Gene

• Entrez ID: 4142
• Gene name: MAS1 proto-oncogene, G protein-coupled receptor
• Gene symbol: MAS1
• Synonyms (NCBI Gene): MAS, MGRA
• Chromosome: 6
• Chromosome location: 6q25.3
• Summary: This gene encodes a class I seven-transmembrane G-protein-coupled receptor. The encoded protein is a receptor for angiotensin-(1-7) and preferentially couples to the Gq protein, activating the phospholipase C signaling pathway. The encoded protein may pla

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001595	Function	Angiotensin receptor activity	IBA
GO:0001595	Function	Angiotensin receptor activity	IEA
GO:0001595	Function	Angiotensin receptor activity	ISS
GO:0002033	Process	Angiotensin-mediated vasodilation involved in regulation of systemic arterial blood pressure	IEA
GO:0004930	Function	G protein-coupled receptor activity	IDA	16611642
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	TAS	3419518
GO:0004945	Function	Angiotensin type II receptor activity	TAS	3419518
GO:0005515	Function	Protein binding	IPI	26460884
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	16611642
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	3419518
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	3419518
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA
GO:0008528	Function	G protein-coupled peptide receptor activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0042277	Function	Peptide binding	IEA
GO:0042277	Function	Peptide binding	ISS
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEA
GO:0050727	Process	Regulation of inflammatory response	IEA
GO:0086097	Process	Phospholipase C-activating angiotensin-activated signaling pathway	IMP	16611642

Other IDs

• MIM: 165180
• HGNC: 6899
• e!Ensembl: ENSG00000130368

Protein

• UniProt ID: P04201
• Protein name: Proto-oncogene Mas
• Protein function: Receptor for angiotensin 1-7 (By similarity). Acts specifically as a functional antagonist of AGTR1 (angiotensin-2 type 1 receptor), although it up-regulates AGTR1 receptor levels. Positive regulation of AGTR1 levels occurs through activation of
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	49 → 280	7 transmembrane receptor (rhodopsin family)	Family

• Sequence:

  MDGSNVTSFVVEEPTNISTGRNASVGNAHRQIPIVHWVIMSISPVGFVENGILLWFLCFR
  MRRNPFTVYITHLSIADISLLFCIFILSIDYALDYELSSGHYYTIVTLSVTFLFGYNTGL
  YLLTAISVERCLSVLYPIWYRCHRPKYQSALVCALLWALSCLVTTMEYVMCIDREEESHS
  RNDCRAVIIFIAILSFLVFTPLMLVSSTILVVKIRKNTWASHSSKLYIVIMVTIIIFLIF
  AMPMRLLYLLYYEYWSTFGNLHHISLLFSTINSSANPFIYFFVGSSKKKRFKESLKVVLT
  RAFKDEMQPRRQKDNCNTVTVETVV

• Sequence length: 325

Pathways

KEGG:

Neuroactive ligand-receptor interaction
Renin-angiotensin system
Coronavirus disease - COVID-19

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THROMBOSIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations