MARK1 (microtubule affinity regulating kinase 1)

Gene

• Entrez ID: 4139
• Gene name: Microtubule affinity regulating kinase 1
• Gene symbol: MARK1
• Synonyms (NCBI Gene): MARK, Par-1c, Par1c
• Chromosome: 1
• Chromosome location: 1q41

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT656421	hsa-miR-1283	HITS-CLIP	23824327
MIRT656420	hsa-miR-3616-5p	HITS-CLIP	23824327
MIRT656419	hsa-miR-573	HITS-CLIP	23824327
MIRT656421	hsa-miR-1283	HITS-CLIP	23824327
MIRT656420	hsa-miR-3616-5p	HITS-CLIP	23824327
MIRT656419	hsa-miR-573	HITS-CLIP	23824327
MIRT737308	hsa-miR-486-5p	Luciferase reporter assay, Western blotting, qRT-PCR	32547110
MIRT656421	hsa-miR-1283	HITS-CLIP	23824327
MIRT656420	hsa-miR-3616-5p	HITS-CLIP	23824327
MIRT656419	hsa-miR-573	HITS-CLIP	23824327
MIRT656421	hsa-miR-1283	HITS-CLIP	23824327
MIRT656420	hsa-miR-3616-5p	HITS-CLIP	23824327
MIRT656419	hsa-miR-573	HITS-CLIP	23824327
MIRT1132532	hsa-miR-101	CLIP-seq
MIRT1132533	hsa-miR-128	CLIP-seq
MIRT1132534	hsa-miR-144	CLIP-seq
MIRT1132535	hsa-miR-221	CLIP-seq
MIRT1132536	hsa-miR-222	CLIP-seq
MIRT1132537	hsa-miR-27a	CLIP-seq
MIRT1132538	hsa-miR-27b	CLIP-seq
MIRT1132539	hsa-miR-300	CLIP-seq
MIRT1132540	hsa-miR-381	CLIP-seq
MIRT1132541	hsa-miR-3922-5p	CLIP-seq
MIRT1132542	hsa-miR-3973	CLIP-seq
MIRT1132543	hsa-miR-4307	CLIP-seq
MIRT1132544	hsa-miR-4503	CLIP-seq
MIRT1132545	hsa-miR-4666-3p	CLIP-seq
MIRT1132546	hsa-miR-4680-3p	CLIP-seq
MIRT1132547	hsa-miR-4724-5p	CLIP-seq
MIRT1132548	hsa-miR-4781-3p	CLIP-seq
MIRT1132549	hsa-miR-499-3p	CLIP-seq
MIRT1132550	hsa-miR-499a-3p	CLIP-seq
MIRT1132551	hsa-miR-513a-3p	CLIP-seq
MIRT1132552	hsa-miR-520g	CLIP-seq
MIRT1132553	hsa-miR-520h	CLIP-seq
MIRT1132554	hsa-miR-567	CLIP-seq
MIRT1132555	hsa-miR-570	CLIP-seq
MIRT1132556	hsa-miR-582-5p	CLIP-seq
MIRT2037758	hsa-miR-1305	CLIP-seq
MIRT2037759	hsa-miR-3671	CLIP-seq
MIRT2037760	hsa-miR-4795-3p	CLIP-seq
MIRT2267825	hsa-miR-3924	CLIP-seq
MIRT2267826	hsa-miR-542-3p	CLIP-seq
MIRT1132532	hsa-miR-101	CLIP-seq
MIRT1132534	hsa-miR-144	CLIP-seq
MIRT2431020	hsa-miR-299-5p	CLIP-seq
MIRT1132551	hsa-miR-513a-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000226	Process	Microtubule cytoskeleton organization	ISS	9108484
GO:0000287	Function	Magnesium ion binding	IDA	14976552
GO:0001764	Process	Neuron migration	ISS
GO:0001786	Function	Phosphatidylserine binding	IDA	21145462
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	14976552
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	NAS	10542369, 28386764
GO:0005515	Function	Protein binding	IPI	23666762, 32296183, 32814053
GO:0005524	Function	ATP binding	IDA	14976552
GO:0005524	Function	ATP binding	IEA
GO:0005546	Function	Phosphatidylinositol-4,5-bisphosphate binding	IDA	21145462
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	23666762
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005856	Component	Cytoskeleton	ISS
GO:0005886	Component	Plasma membrane	IDA	21145462
GO:0005886	Component	Plasma membrane	IEA
GO:0006468	Process	Protein phosphorylation	IDA	14976552
GO:0006468	Process	Protein phosphorylation	IMP	23666762
GO:0007010	Process	Cytoskeleton organization	ISS
GO:0008289	Function	Lipid binding	IEA
GO:0010628	Process	Positive regulation of gene expression	IDA	31281935
GO:0010629	Process	Negative regulation of gene expression	IDA	31281935
GO:0010719	Process	Negative regulation of epithelial to mesenchymal transition	IDA	31281935
GO:0010975	Process	Regulation of neuron projection development	IEA
GO:0010975	Process	Regulation of neuron projection development	ISS
GO:0015630	Component	Microtubule cytoskeleton	TAS	9108484
GO:0016020	Component	Membrane	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030425	Component	Dendrite	IDA	23666762
GO:0030425	Component	Dendrite	IEA
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0035556	Process	Intracellular signal transduction	IDA	14976552
GO:0042995	Component	Cell projection	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048156	Function	Tau protein binding	NAS	28386764
GO:0050321	Function	Tau-protein kinase activity	IMP	23666762
GO:0050321	Function	Tau-protein kinase activity	ISS
GO:0050321	Function	Tau-protein kinase activity	NAS	28386764
GO:0050773	Process	Regulation of dendrite development	IEA
GO:0050773	Process	Regulation of dendrite development	ISS
GO:0051654	Process	Establishment of mitochondrion localization	IEA
GO:0051654	Process	Establishment of mitochondrion localization	ISS
GO:0070300	Function	Phosphatidic acid binding	IDA	21145462
GO:0098794	Component	Postsynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0150052	Process	Regulation of postsynapse assembly	IEA

Other IDs

• MIM: 606511
• HGNC: 6896
• e!Ensembl: ENSG00000116141

Protein

• UniProt ID: Q9P0L2
• Protein name: Serine/threonine-protein kinase MARK1 (EC 2.7.11.1) (EC 2.7.11.26) (MAP/microtubule affinity-regulating kinase 1) (PAR1 homolog c) (Par-1c) (Par1c)
• Protein function: Serine/threonine-protein kinase (PubMed:23666762). Involved in cell polarity and microtubule dynamics regulation. Phosphorylates DCX, MAP2 and MAP4. Phosphorylates the microtubule-associated protein MAPT/TAU (PubMed:23666762). Involved in cell p
• PDB: 2HAK, 3OSE, 6C9D
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00069	Pkinase	60 → 311	Protein kinase domain	Domain
  PF00627	UBA	331 → 367	UBA/TS-N domain	Domain
  PF02149	KA1	751 → 795	Kinase associated domain 1	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in heart, skeletal muscle, brain, fetal brain and fetal kidney. {ECO:0000269|PubMed:9108484}.
• Sequence:

  MSARTPLPTVNERDTENHTSVDGYTEPHIQPTKSSSRQNIPRCRNSITSATDEQPHIGNY
  RLQKTIGKGNFAKVKLARHVLTGREVAVKIIDKTQLNPTSLQKLFREVRIMKILNHPNIV
  KLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKYIVH
  RDLKAENLLLDGDMNIKIADFGFSNEFTVGNKLDTFCGSPPYAAPELFQGKKYDGPEVDV
  WSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKLLVLNPIKRG
  SLEQIMKDRWMNVGHEEEELKPYTEPDPDFNDTKRIDIMVTMGFARDEINDALINQKYDE
  VMATYILLGRKPPEFEGGESLSSGNLCQRSRPSSDLNNSTLQSPAHLKVQRSISANQKQR
  RFSDHAGPSIPPAVSYTKRPQANSVESEQKEEWDKDVARKLGSTTVGSKSEMTASPLVGP
  ERKKSSTIPSNNVYSGGSMARRNTYVCERTTDRYVALQNGKDSSLTEMSVSSISSAGSSV
  ASAVPSARPRHQKSMSTSGHPIKVTLPTIKDGSEAYRPGTTQRVPAASPSAHSISTATPD
  RTRFPRGSSSRSTFHGEQLRERRSVAYNGPPASPSHETGAFAHARRGTSTGIISKITSKF
  VRRDPSEGEASGRTDTSRSTSGEPKERDKEEGKDSKPRSLRFTWSMKTTSSMDPNDMMRE
  IRKVLDANNCDYEQKERFLLFCVHGDARQDSLVQWEMEVCKLPRLSLNGVRFKRISGTSI
  AFKNIASKIANELKL

• Sequence length: 795

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer Disease	Alzheimer disease	Pubtator	21811019, 27879374, 30099988	Associate	★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	20166940		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	18492799		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	18492799, 20166940		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	LHGDN	18492799		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	CTD_human_DG	18492799		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	Pubtator	27879374	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	BEFREE	31563849		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31281935		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	31281935	Associate	★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	31838498		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	36352482	Associate	★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Hemorrhoids	Hemorrhoids	BEFREE	28322687		★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	16367923		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	33967958	Associate	★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	Pubtator	33967958	Associate	★☆☆☆☆ Found in Text Mining only
Ketosis	Ketosis	BEFREE	30578759		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	29431698		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	16367923		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28236972, 31281935		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	25505176		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	23751776		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	30682054		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	34261404	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12665053, 28045069		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	28522732		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28045069		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	24929539		★☆☆☆☆ Found in Text Mining only
Ovarian Serous Adenocarcinoma	Ovarian serous adenocarcinoma	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	24382015		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	28522732		★☆☆☆☆ Found in Text Mining only
Peutz-Jeghers Syndrome	Peutz-Jeghers Syndrome	BEFREE	17924967		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	31066041		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	12679242, 12892855, 14552505, 20166940, 20636287, 22446567		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	16367923		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	16367923, 23829175	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	36352482	Associate	★☆☆☆☆ Found in Text Mining only