MAPT (microtubule associated protein tau)

Gene

• Entrez ID: 4137
• Gene name: Microtubule associated protein tau
• Gene symbol: MAPT
• Synonyms (NCBI Gene): DDPAC, FTD1, FTDP-17, MAPTL, MSTD, MTBT1, MTBT2, PPND, PPP1R103, TAU, Tau-PHF6, tau-40
• Chromosome: 17
• Chromosome location: 17q21.31
• Summary: This gene encodes the microtubule-associated protein tau (MAPT) whose transcript undergoes complex, regulated alternative splicing, giving rise to several mRNA species. MAPT transcripts are differentially expressed in the nervous system, depending on stag

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs63750013	G>A,C	Pathogenic	Intron variant
rs63750092	A>T	Pathogenic, not-provided	Non coding transcript variant, missense variant, coding sequence variant
rs63750129	A>C	Pathogenic, not-provided	Non coding transcript variant, missense variant, coding sequence variant
rs63750162	C>G	Likely-pathogenic	Intron variant
rs63750308	A>G	Pathogenic, not-provided	Intron variant
rs63750349	C>G,T	Pathogenic, not-provided	Synonymous variant, non coding transcript variant, missense variant, coding sequence variant
rs63750376	G>T	Pathogenic, not-provided	Non coding transcript variant, missense variant, coding sequence variant
rs63750424	C>T	Pathogenic	Intron variant, non coding transcript variant, missense variant, coding sequence variant
rs63750425	C>T	Pathogenic, not-provided	Intron variant, non coding transcript variant, missense variant, coding sequence variant
rs63750512	G>A,C	Likely-pathogenic, pathogenic, not-provided	Intron variant, non coding transcript variant, missense variant, coding sequence variant
rs63750568	T>C	Pathogenic, not-provided	Synonymous variant, intron variant, coding sequence variant
rs63750570	G>A	Pathogenic, not-provided	Intron variant, non coding transcript variant, missense variant, coding sequence variant
rs63750635	C>T	Pathogenic, not-provided	Intron variant, non coding transcript variant, missense variant, coding sequence variant
rs63750688	AAG>-	Conflicting-interpretations-of-pathogenicity, not-provided	Inframe deletion, intron variant, coding sequence variant
rs63750711	A>T	Pathogenic, not-provided	Intron variant, non coding transcript variant, missense variant, coding sequence variant
rs63750756	T>G	Pathogenic, not-provided	Intron variant, missense variant, coding sequence variant
rs63750869	G>A	Likely-pathogenic, uncertain-significance	Intron variant, non coding transcript variant, missense variant, coding sequence variant
rs63750912	T>C	Pathogenic, not-provided	Synonymous variant, intron variant, coding sequence variant
rs63750959	G>A,T	Likely-benign, pathogenic, not-provided	Non coding transcript variant, missense variant, coding sequence variant
rs63750972	C>T	Pathogenic, not-provided	Intron variant
rs63751011	C>T	Pathogenic	Intron variant
rs63751165	G>A,T	Pathogenic, not-provided	Intron variant, missense variant, coding sequence variant
rs63751264	A>T	Pathogenic, not-provided	Intron variant, non coding transcript variant, missense variant, coding sequence variant
rs63751273	C>T	Pathogenic	Intron variant, missense variant, coding sequence variant
rs63751391	G>T	Pathogenic, not-provided	Intron variant, missense variant, coding sequence variant
rs63751392	ATA>-	Risk-factor, pathogenic, not-provided	Inframe deletion, intron variant, coding sequence variant
rs63751394	T>C	Pathogenic, not-provided	Intron variant
rs63751438	C>T	Pathogenic, not-provided	Intron variant, missense variant, coding sequence variant
rs63751443	G>A	Conflicting-interpretations-of-pathogenicity	Intron variant
rs143956882	C>T	Conflicting-interpretations-of-pathogenicity, likely-benign	Coding sequence variant, intron variant, missense variant
rs1568327531	G>A	Pathogenic	Intron variant, splice donor variant
rs1568339821	A>G	Likely-pathogenic	Missense variant, coding sequence variant, non coding transcript variant, intron variant
rs1568339995	C>T	Likely-pathogenic	Missense variant, coding sequence variant, non coding transcript variant, intron variant
rs1598408073	G>C	Conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant, non coding transcript variant, intron variant
rs1598408336	C>A	Likely-pathogenic	Missense variant, coding sequence variant, non coding transcript variant, intron variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT007189	hsa-miR-34c-5p	Luciferase reporter assay	23423488
MIRT007189	hsa-miR-34c-5p	Luciferase reporter assay	23423488
MIRT723044	hsa-miR-4793-5p	HITS-CLIP	19536157
MIRT723043	hsa-miR-1915-5p	HITS-CLIP	19536157
MIRT723042	hsa-miR-548q	HITS-CLIP	19536157
MIRT723041	hsa-miR-938	HITS-CLIP	19536157
MIRT723040	hsa-miR-6886-3p	HITS-CLIP	19536157
MIRT723039	hsa-miR-4312	HITS-CLIP	19536157
MIRT723038	hsa-miR-3157-3p	HITS-CLIP	19536157
MIRT723037	hsa-miR-874-3p	HITS-CLIP	19536157
MIRT723036	hsa-miR-6741-5p	HITS-CLIP	19536157
MIRT443435	hsa-miR-4796-3p	PAR-CLIP	22100165
MIRT443434	hsa-miR-3677-5p	PAR-CLIP	22100165
MIRT443432	hsa-miR-8063	PAR-CLIP	22100165
MIRT443433	hsa-miR-520g-3p	PAR-CLIP	22100165
MIRT443431	hsa-miR-520h	PAR-CLIP	22100165
MIRT443430	hsa-miR-4772-3p	PAR-CLIP	22100165
MIRT443429	hsa-miR-2276-3p	PAR-CLIP	22100165
MIRT443428	hsa-miR-3926	PAR-CLIP	22100165
MIRT443427	hsa-miR-4527	PAR-CLIP	22100165
MIRT443426	hsa-miR-6503-5p	PAR-CLIP	22100165
MIRT443425	hsa-miR-518a-5p	PAR-CLIP	22100165
MIRT443424	hsa-miR-527	PAR-CLIP	22100165
MIRT443423	hsa-miR-548s	PAR-CLIP	22100165
MIRT732538	hsa-miR-362-3p	Microarray, qRT-PCR, Western blotting	31496800
MIRT732539	hsa-miR-766-3p	Microarray, qRT-PCR, Western blotting	31496800
MIRT732539	hsa-miR-766-3p	Microarray, qRT-PCR, Western blotting	31496800
MIRT732541	hsa-miR-6507-3p	Microarray, qRT-PCR, Western blotting	31496800
MIRT732670	hsa-miR-181c-5p	In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blotting	32891070
MIRT734258	hsa-miR-483-5p	Western blotting, qRT-PCR	33915734
MIRT723044	hsa-miR-4793-5p	HITS-CLIP	19536157
MIRT723043	hsa-miR-1915-5p	HITS-CLIP	19536157
MIRT723042	hsa-miR-548q	HITS-CLIP	19536157
MIRT723041	hsa-miR-938	HITS-CLIP	19536157
MIRT723040	hsa-miR-6886-3p	HITS-CLIP	19536157
MIRT723039	hsa-miR-4312	HITS-CLIP	19536157
MIRT723038	hsa-miR-3157-3p	HITS-CLIP	19536157
MIRT723037	hsa-miR-874-3p	HITS-CLIP	19536157
MIRT723036	hsa-miR-6741-5p	HITS-CLIP	19536157
MIRT443435	hsa-miR-4796-3p	PAR-CLIP	22100165
MIRT443434	hsa-miR-3677-5p	PAR-CLIP	22100165
MIRT443432	hsa-miR-8063	PAR-CLIP	22100165
MIRT443433	hsa-miR-520g-3p	PAR-CLIP	22100165
MIRT443431	hsa-miR-520h	PAR-CLIP	22100165
MIRT443430	hsa-miR-4772-3p	PAR-CLIP	22100165
MIRT443429	hsa-miR-2276-3p	PAR-CLIP	22100165
MIRT443428	hsa-miR-3926	PAR-CLIP	22100165
MIRT443427	hsa-miR-4527	PAR-CLIP	22100165
MIRT443426	hsa-miR-6503-5p	PAR-CLIP	22100165
MIRT443425	hsa-miR-518a-5p	PAR-CLIP	22100165
MIRT443424	hsa-miR-527	PAR-CLIP	22100165
MIRT443423	hsa-miR-548s	PAR-CLIP	22100165
MIRT1131814	hsa-miR-1207-5p	CLIP-seq
MIRT1131815	hsa-miR-181a	CLIP-seq
MIRT1131816	hsa-miR-181b	CLIP-seq
MIRT1131817	hsa-miR-181c	CLIP-seq
MIRT1131818	hsa-miR-181d	CLIP-seq
MIRT1131819	hsa-miR-3150a-3p	CLIP-seq
MIRT1131820	hsa-miR-3175	CLIP-seq
MIRT1131821	hsa-miR-3616-3p	CLIP-seq
MIRT1131822	hsa-miR-3924	CLIP-seq
MIRT1131823	hsa-miR-421	CLIP-seq
MIRT1131824	hsa-miR-4262	CLIP-seq
MIRT1131825	hsa-miR-4436b-3p	CLIP-seq
MIRT1131826	hsa-miR-4704-5p	CLIP-seq
MIRT1131827	hsa-miR-4709-5p	CLIP-seq
MIRT1131828	hsa-miR-4728-5p	CLIP-seq
MIRT1131829	hsa-miR-4763-3p	CLIP-seq
MIRT1131830	hsa-miR-939	CLIP-seq
MIRT1131831	hsa-miR-1202	CLIP-seq
MIRT1131832	hsa-miR-1207-3p	CLIP-seq
MIRT1131814	hsa-miR-1207-5p	CLIP-seq
MIRT1131833	hsa-miR-1229	CLIP-seq
MIRT1131834	hsa-miR-1266	CLIP-seq
MIRT1131835	hsa-miR-1286	CLIP-seq
MIRT1131836	hsa-miR-1291	CLIP-seq
MIRT1131837	hsa-miR-132	CLIP-seq
MIRT1131838	hsa-miR-1324	CLIP-seq
MIRT1131839	hsa-miR-1470	CLIP-seq
MIRT1131840	hsa-miR-151-5p	CLIP-seq
MIRT1131841	hsa-miR-151b	CLIP-seq
MIRT1131842	hsa-miR-1587	CLIP-seq
MIRT1131815	hsa-miR-181a	CLIP-seq
MIRT1131816	hsa-miR-181b	CLIP-seq
MIRT1131817	hsa-miR-181c	CLIP-seq
MIRT1131818	hsa-miR-181d	CLIP-seq
MIRT1131843	hsa-miR-1915	CLIP-seq
MIRT1131844	hsa-miR-197	CLIP-seq
MIRT1131845	hsa-miR-2053	CLIP-seq
MIRT1131846	hsa-miR-212	CLIP-seq
MIRT1131847	hsa-miR-2467-3p	CLIP-seq
MIRT1131848	hsa-miR-2682	CLIP-seq
MIRT1131849	hsa-miR-27a	CLIP-seq
MIRT1131850	hsa-miR-27b	CLIP-seq
MIRT1131819	hsa-miR-3150a-3p	CLIP-seq
MIRT1131851	hsa-miR-3153	CLIP-seq
MIRT1131852	hsa-miR-3166	CLIP-seq
MIRT1131820	hsa-miR-3175	CLIP-seq
MIRT1131853	hsa-miR-3184	CLIP-seq
MIRT1131854	hsa-miR-3194-5p	CLIP-seq
MIRT1131855	hsa-miR-34a	CLIP-seq
MIRT1131821	hsa-miR-3616-3p	CLIP-seq
MIRT1131856	hsa-miR-3664-3p	CLIP-seq
MIRT1131857	hsa-miR-371b-3p	CLIP-seq
MIRT1131858	hsa-miR-3972	CLIP-seq
MIRT1131823	hsa-miR-421	CLIP-seq
MIRT1131859	hsa-miR-423-5p	CLIP-seq
MIRT1131824	hsa-miR-4262	CLIP-seq
MIRT1131860	hsa-miR-4299	CLIP-seq
MIRT1131861	hsa-miR-4302	CLIP-seq
MIRT1131862	hsa-miR-4307	CLIP-seq
MIRT1131863	hsa-miR-4308	CLIP-seq
MIRT1131864	hsa-miR-4323	CLIP-seq
MIRT1131865	hsa-miR-4426	CLIP-seq
MIRT1131866	hsa-miR-4433	CLIP-seq
MIRT1131825	hsa-miR-4436b-3p	CLIP-seq
MIRT1131867	hsa-miR-4437	CLIP-seq
MIRT1131868	hsa-miR-4456	CLIP-seq
MIRT1131869	hsa-miR-4488	CLIP-seq
MIRT1131870	hsa-miR-449a	CLIP-seq
MIRT1131871	hsa-miR-449b	CLIP-seq
MIRT1131872	hsa-miR-449c	CLIP-seq
MIRT1131873	hsa-miR-4518	CLIP-seq
MIRT1131874	hsa-miR-4534	CLIP-seq
MIRT1131875	hsa-miR-4639-3p	CLIP-seq
MIRT1131876	hsa-miR-4647	CLIP-seq
MIRT1131877	hsa-miR-4653-3p	CLIP-seq
MIRT1131878	hsa-miR-4662b	CLIP-seq
MIRT1131879	hsa-miR-4667-3p	CLIP-seq
MIRT1131880	hsa-miR-4674	CLIP-seq
MIRT1131881	hsa-miR-4697-3p	CLIP-seq
MIRT1131882	hsa-miR-4697-5p	CLIP-seq
MIRT1131826	hsa-miR-4704-5p	CLIP-seq
MIRT1131827	hsa-miR-4709-5p	CLIP-seq
MIRT1131883	hsa-miR-4722-5p	CLIP-seq
MIRT1131828	hsa-miR-4728-5p	CLIP-seq
MIRT1131884	hsa-miR-4731-5p	CLIP-seq
MIRT1131885	hsa-miR-4737	CLIP-seq
MIRT1131829	hsa-miR-4763-3p	CLIP-seq
MIRT1131886	hsa-miR-486-3p	CLIP-seq
MIRT1131887	hsa-miR-487a	CLIP-seq
MIRT1131888	hsa-miR-509-3p	CLIP-seq
MIRT1131889	hsa-miR-5096	CLIP-seq
MIRT1131890	hsa-miR-513a-5p	CLIP-seq
MIRT1131891	hsa-miR-579	CLIP-seq
MIRT1131892	hsa-miR-637	CLIP-seq
MIRT1131893	hsa-miR-646	CLIP-seq
MIRT1131894	hsa-miR-668	CLIP-seq
MIRT1131895	hsa-miR-765	CLIP-seq
MIRT1131896	hsa-miR-885-3p	CLIP-seq
MIRT1131897	hsa-miR-922	CLIP-seq
MIRT1131830	hsa-miR-939	CLIP-seq
MIRT1131898	hsa-miR-940	CLIP-seq
MIRT1131899	hsa-miR-106a	CLIP-seq
MIRT1131900	hsa-miR-106b	CLIP-seq
MIRT1131814	hsa-miR-1207-5p	CLIP-seq
MIRT1131901	hsa-miR-1252	CLIP-seq
MIRT1131834	hsa-miR-1266	CLIP-seq
MIRT1131837	hsa-miR-132	CLIP-seq
MIRT1131902	hsa-miR-142-5p	CLIP-seq
MIRT1131903	hsa-miR-17	CLIP-seq
MIRT1131904	hsa-miR-1976	CLIP-seq
MIRT1131905	hsa-miR-204	CLIP-seq
MIRT1131906	hsa-miR-20a	CLIP-seq
MIRT1131907	hsa-miR-20b	CLIP-seq
MIRT1131908	hsa-miR-211	CLIP-seq
MIRT1131846	hsa-miR-212	CLIP-seq
MIRT1131909	hsa-miR-214	CLIP-seq
MIRT1131910	hsa-miR-3120-3p	CLIP-seq
MIRT1131819	hsa-miR-3150a-3p	CLIP-seq
MIRT1131851	hsa-miR-3153	CLIP-seq
MIRT1131911	hsa-miR-3161	CLIP-seq
MIRT1131912	hsa-miR-3174	CLIP-seq
MIRT1131820	hsa-miR-3175	CLIP-seq
MIRT1131853	hsa-miR-3184	CLIP-seq
MIRT1131913	hsa-miR-3185	CLIP-seq
MIRT1131855	hsa-miR-34a	CLIP-seq
MIRT1131914	hsa-miR-3609	CLIP-seq
MIRT1131821	hsa-miR-3616-3p	CLIP-seq
MIRT1131915	hsa-miR-3619-5p	CLIP-seq
MIRT1131916	hsa-miR-3620	CLIP-seq
MIRT1131856	hsa-miR-3664-3p	CLIP-seq
MIRT1131917	hsa-miR-3675-3p	CLIP-seq
MIRT1131918	hsa-miR-3692	CLIP-seq
MIRT1131919	hsa-miR-3945	CLIP-seq
MIRT1131859	hsa-miR-423-5p	CLIP-seq
MIRT1131920	hsa-miR-4291	CLIP-seq
MIRT1131861	hsa-miR-4302	CLIP-seq
MIRT1131865	hsa-miR-4426	CLIP-seq
MIRT1131825	hsa-miR-4436b-3p	CLIP-seq
MIRT1131870	hsa-miR-449a	CLIP-seq
MIRT1131871	hsa-miR-449b	CLIP-seq
MIRT1131873	hsa-miR-4518	CLIP-seq
MIRT1131874	hsa-miR-4534	CLIP-seq
MIRT1131921	hsa-miR-4635	CLIP-seq
MIRT1131875	hsa-miR-4639-3p	CLIP-seq
MIRT1131876	hsa-miR-4647	CLIP-seq
MIRT1131877	hsa-miR-4653-3p	CLIP-seq
MIRT1131878	hsa-miR-4662b	CLIP-seq
MIRT1131922	hsa-miR-4694-3p	CLIP-seq
MIRT1131881	hsa-miR-4697-3p	CLIP-seq
MIRT1131827	hsa-miR-4709-5p	CLIP-seq
MIRT1131828	hsa-miR-4728-5p	CLIP-seq
MIRT1131923	hsa-miR-4738-3p	CLIP-seq
MIRT1131924	hsa-miR-4755-5p	CLIP-seq
MIRT1131829	hsa-miR-4763-3p	CLIP-seq
MIRT1131925	hsa-miR-4775	CLIP-seq
MIRT1131926	hsa-miR-4797-3p	CLIP-seq
MIRT1131927	hsa-miR-4802-5p	CLIP-seq
MIRT1131889	hsa-miR-5096	CLIP-seq
MIRT1131928	hsa-miR-519d	CLIP-seq
MIRT1131929	hsa-miR-548ah	CLIP-seq
MIRT1131930	hsa-miR-548g	CLIP-seq
MIRT1131891	hsa-miR-579	CLIP-seq
MIRT1131931	hsa-miR-623	CLIP-seq
MIRT1131893	hsa-miR-646	CLIP-seq
MIRT1131932	hsa-miR-759	CLIP-seq
MIRT1131933	hsa-miR-761	CLIP-seq
MIRT1131896	hsa-miR-885-3p	CLIP-seq
MIRT1131897	hsa-miR-922	CLIP-seq
MIRT1131934	hsa-miR-93	CLIP-seq
MIRT1131830	hsa-miR-939	CLIP-seq
MIRT1131889	hsa-miR-5096	CLIP-seq
MIRT1131887	hsa-miR-487a	CLIP-seq
MIRT1131889	hsa-miR-5096	CLIP-seq
MIRT1131832	hsa-miR-1207-3p	CLIP-seq
MIRT1131838	hsa-miR-1324	CLIP-seq
MIRT1131839	hsa-miR-1470	CLIP-seq
MIRT1131847	hsa-miR-2467-3p	CLIP-seq
MIRT2037555	hsa-miR-3065-5p	CLIP-seq
MIRT2037556	hsa-miR-3130-5p	CLIP-seq
MIRT2037557	hsa-miR-3192	CLIP-seq
MIRT2037558	hsa-miR-320a	CLIP-seq
MIRT2037559	hsa-miR-320b	CLIP-seq
MIRT2037560	hsa-miR-320c	CLIP-seq
MIRT2037561	hsa-miR-320d	CLIP-seq
MIRT2037562	hsa-miR-330-3p	CLIP-seq
MIRT2037563	hsa-miR-4429	CLIP-seq
MIRT2037564	hsa-miR-4482	CLIP-seq
MIRT2037565	hsa-miR-4530	CLIP-seq
MIRT2037566	hsa-miR-4650-5p	CLIP-seq
MIRT1131879	hsa-miR-4667-3p	CLIP-seq
MIRT1131827	hsa-miR-4709-5p	CLIP-seq
MIRT1131828	hsa-miR-4728-5p	CLIP-seq
MIRT1131925	hsa-miR-4775	CLIP-seq
MIRT2037567	hsa-miR-505	CLIP-seq
MIRT1131889	hsa-miR-5096	CLIP-seq
MIRT1131891	hsa-miR-579	CLIP-seq
MIRT2037568	hsa-miR-766	CLIP-seq
MIRT2037569	hsa-miR-2861	CLIP-seq
MIRT2037570	hsa-miR-4269	CLIP-seq
MIRT2037571	hsa-miR-4514	CLIP-seq
MIRT2037565	hsa-miR-4530	CLIP-seq
MIRT2037572	hsa-miR-4692	CLIP-seq
MIRT2037573	hsa-miR-4742-5p	CLIP-seq
MIRT1131898	hsa-miR-940	CLIP-seq
MIRT1131832	hsa-miR-1207-3p	CLIP-seq
MIRT1131814	hsa-miR-1207-5p	CLIP-seq
MIRT2267495	hsa-miR-1231	CLIP-seq
MIRT2267496	hsa-miR-1237	CLIP-seq
MIRT2267497	hsa-miR-1248	CLIP-seq
MIRT1131837	hsa-miR-132	CLIP-seq
MIRT1131838	hsa-miR-1324	CLIP-seq
MIRT1131815	hsa-miR-181a	CLIP-seq
MIRT1131816	hsa-miR-181b	CLIP-seq
MIRT1131817	hsa-miR-181c	CLIP-seq
MIRT1131818	hsa-miR-181d	CLIP-seq
MIRT2267498	hsa-miR-1913	CLIP-seq
MIRT1131845	hsa-miR-2053	CLIP-seq
MIRT1131846	hsa-miR-212	CLIP-seq
MIRT1131909	hsa-miR-214	CLIP-seq
MIRT2267499	hsa-miR-22	CLIP-seq
MIRT1131847	hsa-miR-2467-3p	CLIP-seq
MIRT1131849	hsa-miR-27a	CLIP-seq
MIRT1131850	hsa-miR-27b	CLIP-seq
MIRT2037569	hsa-miR-2861	CLIP-seq
MIRT1131910	hsa-miR-3120-3p	CLIP-seq
MIRT2267500	hsa-miR-3125	CLIP-seq
MIRT1131819	hsa-miR-3150a-3p	CLIP-seq
MIRT1131820	hsa-miR-3175	CLIP-seq
MIRT2267501	hsa-miR-3179	CLIP-seq
MIRT1131853	hsa-miR-3184	CLIP-seq
MIRT2037557	hsa-miR-3192	CLIP-seq
MIRT2267502	hsa-miR-324-3p	CLIP-seq
MIRT2267503	hsa-miR-342-3p	CLIP-seq
MIRT1131855	hsa-miR-34a	CLIP-seq
MIRT2267504	hsa-miR-361-3p	CLIP-seq
MIRT1131821	hsa-miR-3616-3p	CLIP-seq
MIRT2267505	hsa-miR-3616-5p	CLIP-seq
MIRT1131915	hsa-miR-3619-5p	CLIP-seq
MIRT1131916	hsa-miR-3620	CLIP-seq
MIRT2267506	hsa-miR-3647-5p	CLIP-seq
MIRT2267507	hsa-miR-3689a-3p	CLIP-seq
MIRT2267508	hsa-miR-3689c	CLIP-seq
MIRT2267509	hsa-miR-377	CLIP-seq
MIRT2267510	hsa-miR-3913-3p	CLIP-seq
MIRT2267511	hsa-miR-3914	CLIP-seq
MIRT2267512	hsa-miR-3916	CLIP-seq
MIRT2267513	hsa-miR-3928	CLIP-seq
MIRT1131823	hsa-miR-421	CLIP-seq
MIRT1131859	hsa-miR-423-5p	CLIP-seq
MIRT2267514	hsa-miR-4252	CLIP-seq
MIRT1131824	hsa-miR-4262	CLIP-seq
MIRT2267515	hsa-miR-4265	CLIP-seq
MIRT2037570	hsa-miR-4269	CLIP-seq
MIRT2267516	hsa-miR-4287	CLIP-seq
MIRT2267517	hsa-miR-4296	CLIP-seq
MIRT1131861	hsa-miR-4302	CLIP-seq
MIRT2267518	hsa-miR-4314	CLIP-seq
MIRT2267519	hsa-miR-4322	CLIP-seq
MIRT2267520	hsa-miR-4417	CLIP-seq
MIRT2267521	hsa-miR-4420	CLIP-seq
MIRT1131865	hsa-miR-4426	CLIP-seq
MIRT1131825	hsa-miR-4436b-3p	CLIP-seq
MIRT2267522	hsa-miR-4453	CLIP-seq
MIRT2267523	hsa-miR-4457	CLIP-seq
MIRT2267524	hsa-miR-4468	CLIP-seq
MIRT2267525	hsa-miR-4469	CLIP-seq
MIRT1131870	hsa-miR-449a	CLIP-seq
MIRT1131871	hsa-miR-449b	CLIP-seq
MIRT2267526	hsa-miR-4504	CLIP-seq
MIRT2267527	hsa-miR-4505	CLIP-seq
MIRT2037571	hsa-miR-4514	CLIP-seq
MIRT2037565	hsa-miR-4530	CLIP-seq
MIRT2267528	hsa-miR-4538	CLIP-seq
MIRT2267529	hsa-miR-4646-5p	CLIP-seq
MIRT1131876	hsa-miR-4647	CLIP-seq
MIRT2267530	hsa-miR-4656	CLIP-seq
MIRT1131878	hsa-miR-4662b	CLIP-seq
MIRT2267531	hsa-miR-4663	CLIP-seq
MIRT2267532	hsa-miR-4677-3p	CLIP-seq
MIRT2267533	hsa-miR-4679	CLIP-seq
MIRT2267534	hsa-miR-4685-3p	CLIP-seq
MIRT2037572	hsa-miR-4692	CLIP-seq
MIRT1131881	hsa-miR-4697-3p	CLIP-seq
MIRT1131827	hsa-miR-4709-5p	CLIP-seq
MIRT2267535	hsa-miR-4710	CLIP-seq
MIRT1131828	hsa-miR-4728-5p	CLIP-seq
MIRT2267536	hsa-miR-4731-3p	CLIP-seq
MIRT1131923	hsa-miR-4738-3p	CLIP-seq
MIRT2267537	hsa-miR-4740-3p	CLIP-seq
MIRT2037573	hsa-miR-4742-5p	CLIP-seq
MIRT2267538	hsa-miR-4749-3p	CLIP-seq
MIRT2267539	hsa-miR-4757-5p	CLIP-seq
MIRT1131829	hsa-miR-4763-3p	CLIP-seq
MIRT1131926	hsa-miR-4797-3p	CLIP-seq
MIRT2267540	hsa-miR-4801	CLIP-seq
MIRT1131927	hsa-miR-4802-5p	CLIP-seq
MIRT2267541	hsa-miR-485-5p	CLIP-seq
MIRT2267542	hsa-miR-489	CLIP-seq
MIRT1131890	hsa-miR-513a-5p	CLIP-seq
MIRT2267543	hsa-miR-520a-5p	CLIP-seq
MIRT2267544	hsa-miR-525-5p	CLIP-seq
MIRT2267545	hsa-miR-542-3p	CLIP-seq
MIRT1131930	hsa-miR-548g	CLIP-seq
MIRT2267546	hsa-miR-550b	CLIP-seq
MIRT2267547	hsa-miR-563	CLIP-seq
MIRT2267548	hsa-miR-573	CLIP-seq
MIRT1131891	hsa-miR-579	CLIP-seq
MIRT2267549	hsa-miR-604	CLIP-seq
MIRT2267550	hsa-miR-615-3p	CLIP-seq
MIRT2267551	hsa-miR-624	CLIP-seq
MIRT2267552	hsa-miR-635	CLIP-seq
MIRT1131893	hsa-miR-646	CLIP-seq
MIRT1131933	hsa-miR-761	CLIP-seq
MIRT1131896	hsa-miR-885-3p	CLIP-seq
MIRT1131897	hsa-miR-922	CLIP-seq
MIRT1131830	hsa-miR-939	CLIP-seq
MIRT1131898	hsa-miR-940	CLIP-seq
MIRT2442344	hsa-miR-3617	CLIP-seq
MIRT2267510	hsa-miR-3913-3p	CLIP-seq
MIRT2442345	hsa-miR-3974	CLIP-seq
MIRT2442346	hsa-miR-4263	CLIP-seq
MIRT2442347	hsa-miR-4761-5p	CLIP-seq
MIRT2442348	hsa-miR-576-5p	CLIP-seq
MIRT2442349	hsa-miR-622	CLIP-seq
MIRT2442350	hsa-miR-641	CLIP-seq
MIRT1131839	hsa-miR-1470	CLIP-seq
MIRT2684609	hsa-miR-199a-5p	CLIP-seq
MIRT2684610	hsa-miR-199b-5p	CLIP-seq
MIRT2684611	hsa-miR-3151	CLIP-seq
MIRT1131861	hsa-miR-4302	CLIP-seq
MIRT2684612	hsa-miR-4447	CLIP-seq
MIRT2684613	hsa-miR-4472	CLIP-seq
MIRT1131879	hsa-miR-4667-3p	CLIP-seq
MIRT2684614	hsa-miR-491-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000226	Process	Microtubule cytoskeleton organization	IBA
GO:0000226	Process	Microtubule cytoskeleton organization	IDA	1057175
GO:0000226	Process	Microtubule cytoskeleton organization	NAS	28377597
GO:0001774	Process	Microglial cell activation	TAS	26363795
GO:0003677	Function	DNA binding	ISS
GO:0003677	Function	DNA binding	TAS	28386764
GO:0003680	Function	Minor groove of adenine-thymine-rich DNA binding	TAS	28386764
GO:0003690	Function	Double-stranded DNA binding	TAS	28386764
GO:0003697	Function	Single-stranded DNA binding	TAS	28386764
GO:0003723	Function	RNA binding	TAS	28386764
GO:0003779	Function	Actin binding	TAS	22920254, 27306859, 28386764
GO:0005515	Function	Protein binding	IPI	3111527, 7566652, 9689133, 10987820, 15953362, 16115884, 16275660, 16446437, 17078951, 17317006, 17932487, 18292230, 19138662, 19527721, 19647741, 20133804, 20655099, 21339331, 21692989, 21985244, 22303461, 22367970, 23399914, 23589030, 23666762, 24028865, 24098548, 24113872, 241653
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	NAS	28386764
GO:0005634	Component	Nucleus	ISS
GO:0005634	Component	Nucleus	TAS	28386764
GO:0005737	Component	Cytoplasm	IDA	23666762, 27356871
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	IMP	26014385, 27044754
GO:0005737	Component	Cytoplasm	ISS
GO:0005739	Component	Mitochondrion	TAS	28386764
GO:0005829	Component	Cytosol	IDA	10747907
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	ISS
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IEA
GO:0005874	Component	Microtubule	ISS
GO:0005886	Component	Plasma membrane	IDA	8522593, 10747907
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	28386764
GO:0006974	Process	DNA damage response	IMP	21131359
GO:0007267	Process	Cell-cell signaling	NAS	28386764
GO:0007416	Process	Synapse assembly	IMP	26704708
GO:0007611	Process	Learning or memory	IMP	26704708
GO:0007613	Process	Memory	IMP	20655099
GO:0008017	Function	Microtubule binding	IBA
GO:0008017	Function	Microtubule binding	IDA	1918161, 28377597
GO:0008017	Function	Microtubule binding	IEA
GO:0008017	Function	Microtubule binding	IMP	10747907
GO:0008017	Function	Microtubule binding	NAS	28386764
GO:0008017	Function	Microtubule binding	TAS	26363795, 26609151
GO:0010288	Process	Response to lead ion	ISS
GO:0010506	Process	Regulation of autophagy	IGI	19074461
GO:0010629	Process	Negative regulation of gene expression	IMP	23164821
GO:0010917	Process	Negative regulation of mitochondrial membrane potential	IMP	22920254
GO:0015630	Component	Microtubule cytoskeleton	IDA	15147841, 27356871, 28377597
GO:0015630	Component	Microtubule cytoskeleton	NAS	26363795, 28386764
GO:0015631	Function	Tubulin binding	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	IMP	20655099
GO:0016072	Process	RRNA metabolic process	TAS	28386764
GO:0017124	Function	SH3 domain binding	IPI	9763511
GO:0019896	Process	Axonal transport of mitochondrion	TAS	26363795
GO:0019899	Function	Enzyme binding	IPI	9736630, 12888622, 20133804
GO:0019899	Function	Enzyme binding	ISS	23362255
GO:0019901	Function	Protein kinase binding	IPI	16923168, 24251416, 25556849
GO:0019901	Function	Protein kinase binding	ISS	17906291
GO:0021954	Process	Central nervous system neuron development	TAS	28386764
GO:0030424	Component	Axon	IDA	8642405
GO:0030424	Component	Axon	IEA
GO:0030424	Component	Axon	NAS	26363795
GO:0030424	Component	Axon	TAS	28386764
GO:0030425	Component	Dendrite	IDA	23666762, 25620700
GO:0030425	Component	Dendrite	IEA
GO:0030426	Component	Growth cone	IDA	8642405
GO:0030673	Component	Axolemma	IDA	10747907
GO:0030674	Function	Protein-macromolecule adaptor activity	TAS	28386764
GO:0031110	Process	Regulation of microtubule polymerization or depolymerization	IMP	27356871
GO:0031113	Process	Regulation of microtubule polymerization	NAS	1057175
GO:0031113	Process	Regulation of microtubule polymerization	TAS	10640627, 28386764
GO:0031116	Process	Positive regulation of microtubule polymerization	IDA	1421571, 7706316
GO:0031122	Process	Cytoplasmic microtubule organization	TAS	26363795
GO:0031175	Process	Neuron projection development	IBA
GO:0031175	Process	Neuron projection development	TAS	26363795
GO:0032930	Process	Positive regulation of superoxide anion generation	IMP	22920254
GO:0033044	Process	Regulation of chromosome organization	TAS	28386764
GO:0034063	Process	Stress granule assembly	TAS	28386764
GO:0034185	Function	Apolipoprotein binding	IPI	7566652
GO:0034399	Component	Nuclear periphery	IDA	19157893
GO:0034452	Function	Dynactin binding	TAS	26363795
GO:0034605	Process	Cellular response to heat	TAS	26363795
GO:0034614	Process	Cellular response to reactive oxygen species	TAS	28386764
GO:0035091	Function	Phosphatidylinositol binding	TAS	28386764
GO:0036464	Component	Cytoplasmic ribonucleoprotein granule	IDA	15121898
GO:0036477	Component	Somatodendritic compartment	IMP	20655099
GO:0036477	Component	Somatodendritic compartment	TAS	28386764
GO:0042802	Function	Identical protein binding	IDA	15654759
GO:0042802	Function	Identical protein binding	IMP	7929085, 14769047, 26014385
GO:0042802	Function	Identical protein binding	IPI	16446437, 17535890, 26436840, 27044754, 30158706, 30274285, 30894745
GO:0042995	Component	Cell projection	IEA
GO:0043005	Component	Neuron projection	IBA
GO:0043025	Component	Neuronal cell body	IMP	20655099
GO:0043197	Component	Dendritic spine	TAS	28386764
GO:0043565	Function	Sequence-specific DNA binding	TAS	28386764
GO:0044297	Component	Cell body	IDA	25620700
GO:0044297	Component	Cell body	ISS
GO:0044304	Component	Main axon	ISS
GO:0045121	Component	Membrane raft	ISS
GO:0045298	Component	Tubulin complex	IDA	8642405
GO:0045773	Process	Positive regulation of axon extension	IDA	1389180
GO:0046785	Process	Microtubule polymerization	IDA	26996940
GO:0046785	Process	Microtubule polymerization	TAS	26996940
GO:0048143	Process	Astrocyte activation	TAS	26363795
GO:0048167	Process	Regulation of synaptic plasticity	TAS	28386764
GO:0048312	Process	Intracellular distribution of mitochondria	IMP	21854751
GO:0048699	Process	Generation of neurons	NAS	8522593
GO:0050808	Process	Synapse organization	IMP	17270732
GO:0050848	Process	Regulation of calcium-mediated signaling	IDA	18272392
GO:0051087	Function	Protein-folding chaperone binding	IPI	25051234
GO:0051258	Process	Protein polymerization	IMP	27044754
GO:0051260	Process	Protein homooligomerization	IPI	26704708
GO:0051721	Function	Protein phosphatase 2A binding	TAS	26363795
GO:0051879	Function	Hsp90 protein binding	IPI	17517623
GO:0061564	Process	Axon development	TAS	26609151
GO:0070507	Process	Regulation of microtubule cytoskeleton organization	IMP	15147841
GO:0070507	Process	Regulation of microtubule cytoskeleton organization	TAS	28386764
GO:0071813	Function	Lipoprotein particle binding	IPI	7972031
GO:0072386	Process	Plus-end-directed organelle transport along microtubule	TAS	26363795
GO:0090140	Process	Regulation of mitochondrial fission	IC	22367970
GO:0090258	Process	Negative regulation of mitochondrial fission	IMP	22920254
GO:0097386	Component	Glial cell projection	ISS
GO:0097418	Component	Neurofibrillary tangle	IDA	2484340
GO:0097418	Component	Neurofibrillary tangle	NAS	25620700
GO:0097435	Process	Supramolecular fiber organization	IDA	15654759
GO:0097435	Process	Supramolecular fiber organization	IMP	14769047
GO:0098930	Process	Axonal transport	NAS	28377597
GO:0098930	Process	Axonal transport	TAS	26363795
GO:0099077	Function	Histone-dependent DNA binding	TAS	28386764
GO:0099609	Function	Microtubule lateral binding	IMP	15147841
GO:1900034	Process	Regulation of cellular response to heat	IMP	21131359
GO:1900452	Process	Regulation of long-term synaptic depression	TAS	28386764
GO:1902474	Process	Positive regulation of protein localization to synapse	IMP	20655099
GO:1902936	Function	Phosphatidylinositol bisphosphate binding	TAS	28386764
GO:1902988	Process	Neurofibrillary tangle assembly	NAS	26363795
GO:1903748	Process	Negative regulation of establishment of protein localization to mitochondrion	IMP	22920254
GO:1903829	Process	Positive regulation of protein localization	IMP	27356871
GO:1904115	Component	Axon cytoplasm	IEA
GO:1904428	Process	Negative regulation of tubulin deacetylation	IGI	19457097
GO:1904428	Process	Negative regulation of tubulin deacetylation	TAS	28386764
GO:1990000	Process	Amyloid fibril formation	EXP	7929085, 14769047
GO:1990000	Process	Amyloid fibril formation	IDA	7929085, 14769047
GO:1990000	Process	Amyloid fibril formation	IEP	14769047
GO:1990000	Process	Amyloid fibril formation	IMP	7929085
GO:1990090	Process	Cellular response to nerve growth factor stimulus	TAS	28386764
GO:1990416	Process	Cellular response to brain-derived neurotrophic factor stimulus	TAS	28386764

Other IDs

• MIM: 157140
• HGNC: 6893
• e!Ensembl: ENSG00000186868

Protein

• UniProt ID: P10636
• Protein name: Microtubule-associated protein tau (Neurofibrillary tangle protein) (Paired helical filament-tau) (PHF-tau)
• Protein function: Promotes microtubule assembly and stability, and might be involved in the establishment and maintenance of neuronal polarity (PubMed:21985311). The C-terminus binds axonal microtubules while the N-terminus binds neural plasma membrane components
• PDB: 1I8H, 2MZ7, 2ON9, 3OVL, 4E0M, 4E0N, 4E0O, 4FL5, 4GLR, 4NP8, 4TQE, 4Y32, 4Y3B, 4Y5I, 5DMG, 5E2V, 5E2W, 5HF3, 5K7N, 5MO3, 5MP1, 5MP3, 5MP5, 5N5A, 5N5B, 5NVB, 5O3L, 5O3O, 5O3T, 5V5B, 5V5C, 5ZIA, 5ZV3, 6BB4, 6CVJ, 6CVN, 6DC8, 6DC9, 6DCA, 6FBW, 6FI5, 6GK7, 6GK8, 6GX5, 6H06, 6HRE, 6HRF, 6LRA, 6N4P, 6NK4, 6NWP
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00418	Tubulin-binding	561 → 591	Tau and MAP protein, tubulin-binding repeat	Family
  PF00418	Tubulin-binding	592 → 622	Tau and MAP protein, tubulin-binding repeat	Family
  PF00418	Tubulin-binding	623 → 653	Tau and MAP protein, tubulin-binding repeat	Family
  PF00418	Tubulin-binding	654 → 685	Tau and MAP protein, tubulin-binding repeat	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in neurons. Isoform PNS-tau is expressed in the peripheral nervous system while the others are expressed in the central nervous system.
• Sequence:

  MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQTPTEDGSEEPG
  SETSDAKSTPTAEDVTAPLVDEGAPGKQAAAQPHTEIPEGTTAEEAGIGDTPSLEDEAAG
  HVTQEPESGKVVQEGFLREPGPPGLSHQLMSGMPGAPLLPEGPREATRQPSGTGPEDTEG
  GRHAPELLKHQLLGDLHQEGPPLKGAGGKERPGSKEEVDEDRDVDESSPQDSPPSKASPA
  QDGRPPQTAAREATSIPGFPAEGAIPLPVDFLSKVSTEIPASEPDGPSVGRAKGQDAPLE
  FTFHVEITPNVQKEQAHSEEHLGRAAFPGAPGEGPEARGPSLGEDTKEADLPEPSEKQPA
  AAPRGKPVSRVPQLKARMVSKSKDGTGSDDKKAKTSTRSSAKTLKNRPCLSPKHPTPGSS
  DPLIQPSSPAVCPEPPSSPKYVSSVTSRTGSSGAKEMKLKGADGKTKIATPRGAAPPGQK
  GQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREP
  KKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLD
  LSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEK
  LDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDT
  SPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL

• Sequence length: 758

Pathways

KEGG:

MAPK signaling pathway
Alzheimer disease
Parkinson disease
Pathways of neurodegeneration - multiple diseases

Reactome:

Caspase-mediated cleavage of cytoskeletal proteins

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Alzheimer disease	Likely pathogenic	rs1568339995	RCV000736259	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Dementia	Pathogenic	rs63751011	RCV000626752	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Frontotemporal dementia	Pathogenic; Likely pathogenic	rs63749974, rs63750568, rs63750013, rs63751394, rs63750308, rs63751011, rs63750095, rs1598408336, rs63751273, rs63750376, rs63750424, rs63750972, rs1568327531, rs63750570, rs63750756, rs63751165, rs63750512, rs63751438, rs63750912, rs63750711, rs63750635, rs63750349, rs63750092, rs1598408073	RCV002513906 RCV000989937 RCV005089559 RCV000015333 RCV000015318 RCV000626753 RCV003514309 RCV002914169 RCV003315208 RCV000015313 RCV000015315 RCV000015316 RCV000015317 RCV000015320 RCV000015321 RCV000015322 RCV000015323 RCV001851871 RCV000015325 RCV000015326 RCV000015327 RCV000995804 RCV000015336 RCV000015338 RCV000823456 RCV000995805	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
MAPT-related disorder	Pathogenic	rs63751011, rs63751273, rs63750424	RCV003415858 RCV003407335 RCV004742226	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Memory impairment	Pathogenic	rs63751011	RCV000626753	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Mental deterioration	Pathogenic	rs63751011	RCV000626753	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Parkinson disease, late-onset	Pathogenic	rs63751392, rs63751273, rs63750424, rs63750756	RCV000015335 RCV000763405 RCV002476970 RCV000763404	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Pick disease	Pathogenic; Likely pathogenic	rs63751273, rs63750424, rs63750756, rs63750512, rs63750129, rs63751264, rs63750635	RCV000763405 RCV002476970 RCV000763404 RCV000015324 RCV000015328 RCV000015329 RCV000015331	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Progressive supranuclear ophthalmoplegia	Pathogenic	rs63751273, rs63750756	RCV000763405 RCV000763404	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Progressive supranuclear palsy-parkinsonism syndrome	Pathogenic	rs63751011, rs63751392, rs63751273, rs63750424, rs63750756	RCV004593990 RCV000015334 RCV000763405 RCV002476970 RCV000763404	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Supranuclear palsy, progressive, 1	Pathogenic; Likely pathogenic	rs63751273, rs63750424, rs63750959, rs63750425, rs63751391, rs63751438	RCV002508757 RCV002476970 RCV002508758 RCV002508759 RCV002508760 RCV004017193	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMERS DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANXIETY DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATAXIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FLUTTER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOSOMAL DOMINANT LATE ONSET PARKINSON DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIAC ARRHYTHMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHIES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLASSIC PROGRESSIVE SUPRANUCLEAR PALSY SYNDROME	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COGNITION DISORDERS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEGENERATIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DELIRIUM, DEMENTIA, AMNESTIC, COGNITIVE DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DILATED CARDIOMYOPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSLEXIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Early-onset dementia of unclear type	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPSY, TEMPORAL LOBE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR POSITIVE BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FRONTOTEMPORAL DEMENTIA 1	—	HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GENERALIZED ANXIETY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC PULMONARY FIBROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTERSTITIAL LUNG DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET PARKINSON DISEASE	—	GenCC	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEARNING DISABILITIES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEARNING DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAPT-Related Spectrum Disorders	Benign; Conflicting classifications of pathogenicity; Likely benign; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MEMORY DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple system atrophy	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEGENERATIVE DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEGENERATIVE DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS OF HIP	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	CTD, GWAS catalog CTD, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON-DEMENTIA SYNDROME	—	HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinsonian disorder	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSONIAN DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POST-TRAUMATIC STRESS DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY BILIARY CIRRHOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY CARDIOMYOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROGRESSIVE SUPRANUCLEAR PALSY	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROGRESSIVE SUPRANUCLEAR PALSY ATYPICAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROGRESSIVE SUPRANUCLEAR PALSY CORTICOBASAL SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROGRESSIVE SUPRANUCLEAR PALSY PARKINSONISM SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROGRESSIVE SUPRANUCLEAR PALSY-CORTICOBASAL SYNDROME	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROGRESSIVE SUPRANUCLEAR PALSY-PREDOMINANT PARKINSONISM SYNDROME	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROGRESSIVE SUPRANUCLEAR PALSY-PROGRESSIVE NON-FLUENT APHASIA SYNDROME	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROGRESSIVE SUPRANUCLEAR PALSY-PURE AKINESIA WITH GAIT FREEZING SYNDROME	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHOMOTOR AGITATION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RETINAL DETACHMENT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Semantic dementia	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPLENOMEGALY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Abulia	Abulia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Acquired Kyphoscoliosis	Acquired Kyphoscoliosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Acute Confusional Senile Dementia	Senile Dementia	CTD_human_DG	12852432, 14517953, 15750215, 20157255, 21715663, 25352456, 27117003		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	19467705		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	11836553		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	19467705		★☆☆☆☆ Found in Text Mining only
Adult Learning Disorders	Learning Disorders	CTD_human_DG	22430071, 24556215		★☆☆☆☆ Found in Text Mining only
Age-Related Memory Disorders	Age-Related Memory Disorders	CTD_human_DG	12368474, 22430071, 24556215, 29203278, 29860433		★☆☆☆☆ Found in Text Mining only
Akinesia	Akinesia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Alexia	Alexia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	GWASCAT_DG	28196072		★☆☆☆☆ Found in Text Mining only
Alopecia, Androgenetic, 1	Androgenetic Alopecia	GWASCAT_DG	29146897		★☆☆☆☆ Found in Text Mining only
Alopecia, Androgenetic, 2	Androgenetic Alopecia	GWASCAT_DG	29146897		★☆☆☆☆ Found in Text Mining only
Alopecia, Androgenetic, 3	Androgenetic Alopecia	GWASCAT_DG	29146897		★☆☆☆☆ Found in Text Mining only
Alopecia, Male Pattern	Alopecia, Male Pattern	GWASDB_DG	22693459		★☆☆☆☆ Found in Text Mining only
Alopecia, Male Pattern	Alopecia, Male Pattern	GWASCAT_DG	29146897		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	10037497, 10214944, 10599054, 10805776, 10840038, 11013236, 11303790, 11438574, 11852060, 12023276, 12032355, 12065626, 12414518, 12580546, 12801934, 12826674, 12853572, 12944375, 14511120, 14655750, 14685691, 14757934, 14761950, 14997933, 15341514, 15356202, 15474035, 15733856, 15792962, 15920161, 16006664, 16014629, 16181410, 16191223, 16257959, 16364302, 16364303, 16371011, 1644173, 16443603, 16478530, 16495230, 16687396, 16764677, 1712107, 17266954, 17428800, 17482359, 17512525, 17565981, 17675576, 17723255, 17727636, 17761424, 18430997, 18431250, 18458217, 18541914, 18562203, 18725924, 18769671, 18852354, 19010781, 19046355, 19091059, 19124691, 1915258, 19233276, 19240967, 19247475, 19251758, 19363261, 19420940, 19451179, 19615060, 19623258, 19659459, 19681044, 19919107, 19995442, 20067632, 20110615, 20298971, 20377991, 20437581, 20457142, 20566652, 20697045, 20862329, 20927385, 20930284, 20974297, 21132543, 21159009, 2119143, 21210655, 21212632, 21288907, 21347408, 21398043, 21416485, 21459483, 21498513, 21515431, 21573099, 21577325, 21613474, 21685912, 21755121, 21811019, 21919991, 21942206, 21966400, 21983012, 22009441, 22027014, 22033876, 22039833, 22142809, 22184106, 22193544, 22222721, 22236337, 22253473, 22272245, 22312439, 22343013, 22344463, 22366796, 22532456, 22536436, 22556362, 22615831, 22676853, 22699906, 22723018, 22862741, 22876315, 22911757, 22927204, 22950410, 22968369, 22995835, 23088643, 23093013, 23145103, 23159938, 23300433, 23371364, 23518664, 23550703, 23562540, 23573206, 23585566, 23613741, 23727081, 23727082, 23951306, 23951348, 23965742, 23990795, 24014289, 24023061, 24032460, 24063855, 24067654, 24086518, 24252707, 24348898, 24436131, 24453187, 24524897, 24533944, 24559475, 24731519, 24735980, 24756381, 24869773, 24899730, 24902845, 24923570, 24952994, 25027320, 25088003, 25126942, 25128526, 25222200, 25307156, 25332170, 25336154, 25365775, 25575135, 25651436, 25680531, 25687773, 25689303, 25742170, 25751166, 25791428, 25899925, 25912737, 25921538, 25974414, 26068894, 26101858, 26123052, 26165593, 26208804, 26220940, 26252872, 26270474, 26333800, 26373282, 26402409, 26444757, 26507309, 26519433, 26573292, 26696252, 26720731, 26756745, 26791227, 26800003, 26812251, 26813969, 26825611, 26837465, 26923020, 26936765, 26950848, 26962052, 26988843, 27013866, 27036121, 27036949, 27079717, 27079723, 27080260, 27094739, 27099072, 27129267, 27143424, 27207326, 27287230, 27357286, 27357347, 27383765, 27392867, 27448508, 27460788, 27466139, 27521573, 27532054, 27548710, 27589530, 27601475, 27605218, 27622770, 27701409, 27709663, 27718298, 27776828, 27802219, 27832767, 27834776, 27884212, 27899424, 27901073, 27911827, 27926491, 27997036, 28003242, 28006031, 28019685, 28025562, 28077166, 28087578, 28130473, 28196768, 28222213, 28241163, 28473694, 28558704, 28587659, 28594853, 28747523, 28755476, 28819146, 28893185, 28919235, 28966121, 28974363, 28974731, 29053874, 29062035, 29070909, 29105977, 29113604, 29125490, 29155708, 29177679, 29254665, 29259137, 29274321, 29293892, 29298892, 29323751, 29331531, 29360470, 29402847, 29435558, 29440563, 29474672, 29476081, 29486463, 29495441, 29516269, 29558979, 29559004, 29579160, 29615132, 29684271, 29716656, 29729314, 29734651, 29748322, 29750252, 29859871, 29861166, 29934873, 29945658, 29953200, 29967939, 30014553, 30021611, 30024984, 30036493, 30064522, 30079475, 30086796, 30124450, 30230243, 30238240, 30242125, 30276465, 30318785, 30329219, 30351346, 30372681, 30374196, 30382187, 30390679, 30467822, 30508025, 30549411, 30559478, 30563962, 30573871, 30573872, 30578620, 30611996, 30615028, 30630532, 30679421, 30683981, 30704514, 30708351, 30720432, 30734106, 30753379, 30763379, 30770886, 30783169, 30783207, 30840313, 30856114, 30863455, 30893872, 30902060, 30909239, 30917570, 30922415, 30981993, 30992433, 31017923, 31104335, 31165862, 31182772, 31195602, 31200149, 31211344, 31217032, 31256128, 31266806, 31305320, 31306137, 3131773, 31350575, 31353852, 31358628, 31362787, 31410194, 31504236, 31536662, 31543469, 31600059, 31635074, 31646584, 31653695, 31653847, 31700063, 31733655, 31796124, 31810826, 31824497, 31825500, 31834353, 31848379, 31848674, 31866416, 31889402, 31915189, 31918679, 31959733, 32001514, 32029236, 32032505, 32033164, 32057937, 32065850, 32072450, 32091549, 32123386, 32155994, 32161362, 32161412, 32166339, 32170138, 32182160, 32192521, 32208437, 32228870, 32291284, 32293805, 32300132, 32301581, 32323319, 32364710, 32366888, 32391858, 32393582, 32400971, 32437347, 32474469, 32486218, 32539856, 32568358, 32572268, 32572562, 32575375, 32580499, 32581318, 32589876, 32620704, 32665027, 32681213, 32737076, 32749525, 32756195, 32759167, 32762790, 32808011, 32812023, 32817639, 32825838, 32833429, 32846925, 32854315, 32867562, 32929366, 32967721, 32979285, 33081847, 33087140, 33093220, 33106314, 33129344, 33129364, 33183357, 33188183, 33188775, 33213513, 33215319, 33262228, 33262278, 33267804, 33380426, 33408150, 33419453, 33432193, 33439987, 33441136, 33451357, 33521872, 33536571, 33609158, 33617650, 33646147, 33649380, 33660812, 33724164, 33809978, 33811735, 33820886, 33824317, 33832546, 33835157, 33910019, 33915734, 33927414, 33930462, 33934221, 33980303, 33983116, 34002449, 34031605, 34032364, 34034805, 34119372, 34121475, 34128081, 34158479, 34164834, 34180956, 34195681, 34209408, 34219716, 34219733, 34252884, 34254442, 34342183, 34363663, 34373896, 34375027, 34399127, 34418401, 34424272, 34426604, 34426645, 34469849, 34493616, 34515411, 34581957, 34587152, 34588422, 34588692, 34602080, 34617306, 34626223, 34638000, 34664612, 34712240, 34775974, 34796642, 34818016, 34820873, 34838590, 34873815, 34874463, 34920091, 34924376, 34977242, 34985969, 35022652, 35045380, 35051675, 35063084, 35099506, 35135879, 35173266, 35177665, 35202653, 35204700, 35204764, 35209952, 35218773, 35246269, 35248531, 35258170, 35269542, 35303916, 35306760, 35346299, 35351181, 35358703, 35358831, 35380901, 35382259, 35408478, 35412102, 35421130, 35447369, 35471588, 35567427, 35610289, 35617280, 35691047, 35731895, 35760982, 35799293, 35819518, 35838824, 35843356, 35871112, 35887339, 35895837, 35907254, 35925685, 35933956, 35945628, 36001141, 36001963, 36039594, 36041266, 36042609, 36067305, 36088959, 36112222, 36153390, 36160042, 36162501, 36171642, 36201209, 36214568, 36271678, 36276649, 36379402, 36399096, 36501121, 36512526, 36513817, 36516115, 36533443, 36572121, 36588011, 36626935, 36630781, 36701211, 36745855, 36795937, 36830589, 36847012, 36867706, 36972319, 36982371, 37010714, 37014788, 37075845, 37079306, 37095250, 37175990, 37188537, 37188718, 37231491, 37247383, 37268240, 37277809, 37279390, 37330289, 37348871, 37349319, 37433038, 37440260, 37468915, 37485642, 37510227, 37525358, 37533060, 37536279, 37569528, 37577852, 37735227, 37737824, 37794492, 37815445, 37867465, 37875471, 37884611, 37898823, 37904205, 37918868, 37930695, 37990786, 38002954, 38007664, 38037144, 38093390, 38128829, 38134678, 38157874, 38160357, 38160360, 38176923, 38181704, 38233149, 38236720, 38289539, 38310108, 38408247, 38454193, 38528318, 38631766, 39186798, 39337715, 39343862, 39380021, 39426463, 39497301, 39510192, 39632332, 39639576, 39670385, 39684582, 39753133, 39763384, 39773760, 39824235, 39913635, 39930501, 39937274, 39955563, 39962560, 39994734, 40044591, 40044789, 40057456, 40082954, 40088886, 40118053, 40164724, 40179230, 40187909, 40318118, 40334744, 40342276, 40363838, 40401986, 40407905, 40411302, 40480976, 40545561, 40551292, 40588692, 40595476, 40595720, 40616179, 40619807, 40640137, 40665403, 40665482, 40667715, 6427297, 7534068, 7679073, 7679548, 7805890, 7972031, 7992850, 8129042, 8419321, 9312151, 9326300, 9546349, 9689133, 9811325	Associate	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Alzheimer Disease	Alzheimer disease	Pubtator	17400380, 19494431, 19746990, 20414590, 20570401, 21971452, 25212463, 26328896, 27459603, 28641921, 29402979, 30735395, 30830207, 31167810, 32485097, 32842621, 33139712, 33252078, 37191905, 37331354, 37620502, 7992832	Stimulate	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Alzheimer Disease	Alzheimer disease	Pubtator	31068645	Inhibit	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Alzheimer Disease, Early Onset	Alzheimer disease	BEFREE	10624829, 16866983, 19091059, 21034535, 26159201		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Early Onset	Alzheimer disease	CTD_human_DG	12852432, 14517953, 15750215, 20157255, 21715663, 25352456, 27117003		★☆☆☆☆ Found in Text Mining only
Alzheimer disease, familial, type 3	Alzheimer disease	BEFREE	26333800, 29044447		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	CTD_human_DG	12852432, 14517953, 15750215, 20157255, 21715663, 25352456, 27117003		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	17266761, 19308965, 21443865, 22027014, 22176350, 24309291, 26159201, 26444794, 27829172, 30386171, 31824497		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	CTD_human_DG	12852432, 14517953, 15750215, 20157255, 21715663, 25352456, 27117003		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease, Focal Onset	Alzheimer disease	CTD_human_DG	12852432, 14517953, 15750215, 20157255, 21715663, 25352456, 27117003		★☆☆☆☆ Found in Text Mining only
Amnesia	Amnesia	BEFREE	17409229, 19879019, 25763997, 30478674, 30546007, 30728442, 31653847		★☆☆☆☆ Found in Text Mining only
Amnesia	Amnesia	Pubtator	26297556	Associate	★☆☆☆☆ Found in Text Mining only
Amyloid angiopathy	Amyloid angiopathy	Pubtator	8570627	Associate	★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	15034781, 16788822, 19104446, 19221889, 19967412, 20164595, 2110505, 21875408, 21980472, 24524897, 24581480, 24819465, 24833601, 25026432, 25116835, 25212914, 25960448, 26481403, 26897372, 26971934, 26991855, 27401064, 27562180, 27984697, 28004401, 28164774, 28213439, 28246183, 28490214, 28559789, 28697973, 28726050, 28726727, 28729832, 28865961, 28962579, 29037207, 29107845, 29138750, 29141977, 29396637, 29941717, 29948175, 29948552, 30003951, 30033276, 30128693, 30220236, 30261139, 30408495, 30511118, 30605056, 31029051, 31029057, 31273083, 31482248, 31503421, 31642777, 31673052, 31701556, 31753135, 31771069, 31815669, 31848379		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	LHGDN	18382889		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	Pubtator	34342183, 35617280	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	10595524, 11708997, 14694044, 16005901, 17185385, 20498436, 22853691, 25573097, 28402959, 28680391, 28848086, 28916533, 28980860, 29630712, 29731706, 30210445, 30290707, 30893702, 31176718		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	LHGDN	18843496		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	19046355, 24086518, 28077166, 29630712, 31131395, 34779076, 36952379, 38002967	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Amyotrophic lateral sclerosis 1	Amyotrophic lateral sclerosis	Pubtator	20558945, 31131395	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Familial	Amyotrophic lateral sclerosis	BEFREE	15538967		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Guam Form	Amyotrophic lateral sclerosis	BEFREE	12899197		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Sporadic	Lateral Sclerosis	BEFREE	24387985		★☆☆☆☆ Found in Text Mining only
Androgenetic Alopecia	Androgenetic Alopecia	GWASCAT_DG	29146897		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anomia	Anomia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	GWASCAT_DG	29942085		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	35917404, 37806671	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	HPO_DG			★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	CTD_human_DG	29860433		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety States, Neurotic	Anxiety Disorder	CTD_human_DG	29860433		★☆☆☆☆ Found in Text Mining only
Aphasia	Aphasia	Pubtator	29113604, 36001141	Associate	★☆☆☆☆ Found in Text Mining only
Aphasia	Aphasia	Pubtator	37485642	Stimulate	★☆☆☆☆ Found in Text Mining only
Aphasia	Aphasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Apnea	Apnea	Pubtator	24439479	Stimulate	★☆☆☆☆ Found in Text Mining only
Apraxia of Phonation	Apraxia	BEFREE	26402116, 29969053		★☆☆☆☆ Found in Text Mining only
Apraxia of Phonation	Apraxia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Apraxias	Apraxia	Pubtator	29935044, 29969053, 38007664	Associate	★☆☆☆☆ Found in Text Mining only
Apraxias	Apraxia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	28586827	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	31866416	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia	Ataxia	Pubtator	24086518	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	37569528	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	GWASCAT_DG	29892015		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial Fibrillation	CTD_human_DG	29892015		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrophy	Atrophy	Pubtator	19255408, 19786698, 20045477, 21753165, 21908872, 23043292, 25448043, 25574752, 26507310, 26843008, 28160067, 28241163, 29793546, 30086796, 31200149, 31542807, 31784375, 31870644, 32161412, 32572464, 32929366, 33112398, 33247623, 33568215, 34158384, 34366349, 34494711, 34617306, 35584575, 36192766, 36474176, 36895129, 37182866, 37280592, 37485642, 38544341, 39937274, 40174910, 40673371	Associate	★☆☆☆☆ Found in Text Mining only
Attention Deficit and Disruptive Behavior Disorders	Attention deficit hyperactivity disorder	Pubtator	31915189	Stimulate	★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	27357347	Associate	★☆☆☆☆ Found in Text Mining only
Auditory Perceptual Disorders	Auditory perceptual disorder	Pubtator	36538154	Stimulate	★☆☆☆☆ Found in Text Mining only
AURAL ATRESIA, CONGENITAL	Aural Atresia, Congenital	BEFREE	28282808		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	31511657, 37907504	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	31511657		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	40132252	Associate	★☆☆☆☆ Found in Text Mining only
Autonomic Nervous System Diseases	Autonomic nervous system disease	Pubtator	38134678	Associate	★☆☆☆☆ Found in Text Mining only
Autonomic nervous system disorders	Autonomic Central Nervous System Diseases	BEFREE	12492138		★☆☆☆☆ Found in Text Mining only
Autosomal Dominant Juvenile Parkinson Disease	Parkinson Disease	CTD_human_DG	10802785, 19458322		★☆☆☆☆ Found in Text Mining only
Autosomal Dominant Parkinsonism	Parkinsonian disease	CTD_human_DG	10802785, 19458322		★☆☆☆☆ Found in Text Mining only
Autosomal Recessive Parkinsonism	Parkinsonian disease	CTD_human_DG	10802785, 19458322		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	29932870		★☆☆☆☆ Found in Text Mining only
Basal Ganglia Diseases	Basal ganglia disease	Pubtator	28133816, 28939709, 35799292	Associate	★☆☆☆☆ Found in Text Mining only
Behavior Disorders	Behavior Disorders	BEFREE	31642777		★☆☆☆☆ Found in Text Mining only
Behavioral variant of frontotemporal dementia	Behavioral Variant Of Frontotemporal Dementia	BEFREE	20598713, 21849646, 22532172, 24510641, 24994843, 25363208, 26338813, 30458895, 30704514		★☆☆☆☆ Found in Text Mining only
Behavioral variant of frontotemporal dementia	Behavioral Variant Of Frontotemporal Dementia	ORPHANET_DG	23597030		★☆☆☆☆ Found in Text Mining only
Behavioral variant of frontotemporal dementia	Behavioral Variant Of Frontotemporal Dementia	Orphanet			★☆☆☆☆ Found in Text Mining only
Blepharospasm	Blepharospasm	HPO_DG			★☆☆☆☆ Found in Text Mining only
Brain atrophy	Brain atrophy	BEFREE	21753165, 22784036, 23519520, 28583116, 30086796, 30405709, 31099321		★☆☆☆☆ Found in Text Mining only
Brain atrophy	Brain atrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	15489396, 21685912, 21753165, 26556772, 31653847, 33247623, 33955002, 34742335, 35352105, 40437880	Associate	★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	20570401, 21971452	Stimulate	★☆☆☆☆ Found in Text Mining only
Brain Injuries	Brain injuries	Pubtator	39314520	Associate	★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	26556772, 30901365, 31484787	Associate	★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	29717219	Stimulate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	BEFREE	30096486, 30282370, 30545070, 31713815		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	LHGDN	17951083		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	30535461		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	30700265, 35229396, 37894731	Associate	★☆☆☆☆ Found in Text Mining only
Brain Stem Neoplasms	Brain stem neoplasms	Pubtator	35422444, 38605589	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15914550, 18668363, 20579400, 21062914, 21679412, 26408675, 27221882, 28133523, 30074401, 30535461		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	GWASCAT_DG	29059683		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	15914550, 16721363, 17404087, 20228842, 20579400, 21062914, 21679412, 22976542, 23446558, 25725586, 27221882, 30700265, 34406386, 35990656, 37110517, 38251461	Associate	★☆☆☆☆ Found in Text Mining only
Broca Aphasia	Broca Aphasia	BEFREE	9629852		★☆☆☆☆ Found in Text Mining only
Broca Aphasia	Broca Aphasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Bulbo-Spinal Atrophy, X-Linked	Bulbospinal Atrophy, X-Linked	BEFREE	21317158		★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	28087578	Associate	★☆☆☆☆ Found in Text Mining only
Calcium Metabolism Disorders	Calcium metabolism disorders	Pubtator	30840313	Associate	★☆☆☆☆ Found in Text Mining only
Camurati-Engelmann Syndrome	Diaphyseal dysplasia	BEFREE	16899997, 20547614		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	26408675		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	23631819, 25658796, 30559148	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	18065436, 29215599	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	23631819, 30394813, 30559148		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	CTD_human_DG	29068127		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies, Primary	Cardiomyopathy	CTD_human_DG	29068127		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	10818513		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	25574752	Associate	★☆☆☆☆ Found in Text Mining only
Cerebellar atrophy	Cerebellar atrophy	BEFREE	26977398		★☆☆☆☆ Found in Text Mining only
Cerebellar Diseases	Cerebellar diseases	Pubtator	36895129	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Amyloid Angiopathy	Cerebral amyloid angiopathy	Pubtator	19743453, 26988843, 34128081	Associate	★☆☆☆☆ Found in Text Mining only
CEREBRAL AMYLOID ANGIOPATHY, ITM2B-RELATED, 1	Cerebral Amyloid Angiopathy	BEFREE	11914409		★☆☆☆☆ Found in Text Mining only
Cerebral atrophy	Cerebral Atrophy	BEFREE	16246446, 21753165, 22784036, 23519520, 28583116, 29568692, 30086796, 30405709, 30902161, 31099321, 31481130, 8846237		★☆☆☆☆ Found in Text Mining only
Cerebral atrophy	Cerebral Atrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cerebral cortical atrophy	Cerebral cortical atrophy	BEFREE	16246446		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	27629097		★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	Pubtator	26988843	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Small Vessel Diseases	Cerebral microangiopathy	Pubtator	35044500	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	27189884		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	26159191		★☆☆☆☆ Found in Text Mining only
Child Development Disorders, Pervasive	Development Disorder	GWASCAT_DG	30804558		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	19467705		★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	19906423, 8052267		★☆☆☆☆ Found in Text Mining only
Chromosome 17q21.31 Deletion Syndrome	Chromosome 17q21.31 deletion syndrome	Pubtator	18628315, 21094706	Associate	★☆☆☆☆ Found in Text Mining only
Classic progressive supranuclear palsy syndrome	Supranuclear Palsy	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CNS disorder	CNS Disorder	BEFREE	27662303		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	16219306, 22678764, 23121543, 23390180, 23781007, 25002573, 26991855, 27073221, 27401747, 27486879, 28827321, 29471055, 29665406, 30223691, 30599271, 31724513		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cognition Disorders	Cognition disorder	Pubtator	16478530, 17428800, 18803694, 19046355, 19420940, 20862329, 22039833, 22595371, 23562540, 25088003, 25596881, 26843008, 27061069, 27697694, 27832767, 28019685, 28077166, 29053874, 29062035, 29082658, 29177679, 29627938, 30086796, 30382187, 30734106, 30753379, 30856114, 31200149, 31358058, 31362787, 31410194, 31834353, 31889402, 31915896, 31918679, 32050258, 32367269, 32678011, 33094327, 33106314, 33439987, 33451357, 33682714, 33876815, 34002691, 34158479, 34258926, 34418401, 34473944, 34873815, 34985969, 35022652, 35099506, 35106798, 35179198, 35202653, 35351181, 35380901, 35412102, 35485527, 35670275, 35698882, 35907254, 36214568, 36271678, 36356475, 36501121, 36701211, 37191905, 37231491, 37236204, 37670234, 37930695, 38128829, 38454193, 38544341, 39594668, 39667908, 39670385, 40435794, 40551292, 40619807, 40677151	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cognition Disorders	Cognitive disorder	CTD_human_DG	24556215, 26945731		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cognition Disorders	Cognition disorder	Pubtator	26791227, 37673381	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cognitive Dysfunction	Cognition disorder	Pubtator	19420940, 22911757, 23613741, 25751166, 26682693, 27459603, 28133816, 30014553, 31211344, 31410194, 31653847, 32955460, 33215319, 33682714, 34399127, 35694921, 39955563	Associate	★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	36538154, 37742656	Stimulate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	28586827	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	28715472		★☆☆☆☆ Found in Text Mining only
Compulsive hoarding	Compulsive Hoarding	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital anomaly of face	Facial dysmorphism	BEFREE	22817714		★☆☆☆☆ Found in Text Mining only
Congenital kyphoscoliosis	Congenital kyphoscoliosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital macrodactylia	Congenital macrodactylia	BEFREE	27840953		★☆☆☆☆ Found in Text Mining only
Connective Tissue Diseases	Connective tissue disease	Pubtator	29634760	Associate	★☆☆☆☆ Found in Text Mining only
Corticobasal Degeneration	Corticobasal degeneration	Pubtator	10037497, 10209184, 12057909, 12435607, 15792962, 17602795, 18854867, 19001166, 21823158, 22027014, 22556362, 22595371, 22723018, 22862741, 22950410, 23338750, 23371366, 23432126, 23518664, 24121548, 24252525, 26077951, 26936765, 27529406, 28077166, 28087578, 28100725, 28268100, 28271184, 28473694, 29084565, 29113604, 29253099, 29969053, 31542807, 31631020, 31950334, 31999351, 32032505, 32050258, 32518146, 32759167, 33287913, 34128081, 34342183, 34588692, 34686217, 34823271, 35485527, 35976433, 37349319, 37431188, 37803326, 37904205, 38605589, 38631765, 39510192, 40082954	Associate	★☆☆☆☆ Found in Text Mining only
Corticobasal degeneration	Corticobasal Degeneration	BEFREE	10959034, 10983715, 11193179, 11425937, 11520930, 12231446, 15036206, 15495240, 15615630, 15792962, 15892300, 16221853, 16239184, 16554120, 16987883, 17085483, 17174556, 17386961, 18093153, 18162161, 18854867, 20498436, 20704554, 20858961, 21908872, 22027014, 22723018, 24861427, 26936765, 28233851, 28402959, 29084565, 29206491, 29232559, 29253099, 30193298, 30674342, 31327044, 31366728, 31631020, 7572077		★☆☆☆☆ Found in Text Mining only
Craniocerebral Trauma	Craniocerebral trauma	Pubtator	34172091	Associate	★☆☆☆☆ Found in Text Mining only
Creutzfeldt-Jakob Disease, Familial	Creutzfeldt-Jakob disease	BEFREE	11400017		★☆☆☆☆ Found in Text Mining only
Creutzfeldt-Jakob Disease, Sporadic	Creutzfeldt-Jakob disease	BEFREE	20855493, 22016658, 27357003		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	28586827	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative brain disorder	Degenerative Brain Disorder	BEFREE	11898551, 31698867		★☆☆☆☆ Found in Text Mining only
Degenerative Diseases, Central Nervous System	Degenerative Diseases, Central Nervous System	CTD_human_DG	22430071, 9789048		★☆☆☆☆ Found in Text Mining only
Degenerative Diseases, Spinal Cord	Degenerative Diseases, Central Nervous System	CTD_human_DG	22430071, 9789048		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	GWASCAT_DG	30664745		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	31572443		★☆☆☆☆ Found in Text Mining only
Deglutition Disorders	Dysphagia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Delusions	Delusions	BEFREE	25306292		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	10076890, 10076900, 10202939, 10329720, 10374757, 10412802, 10430438, 10446810, 10465706, 10683298, 10924769, 10983715, 11810290, 11921059, 12056930, 12872001, 12876142, 12891666, 14568818, 15036206, 15056452, 15178940, 15596617, 15671021, 15750210, 16495230, 16899997, 17683088, 17715352, 17954934, 18284428, 18953105, 19503072, 19769346, 19812213, 20178834, 20187245, 20522014, 20668182, 20852909, 20930301, 21157024, 21320871, 21403021, 21530001, 21555888, 21593513, 21785996, 21849646, 22169201, 22419166, 22802095, 23519520, 23727082, 24086739, 24150109, 24757111, 24905038, 25025689, 25575135, 25900293, 26143746, 26159191, 26295349, 26444794, 26758828, 27061069, 27210553, 27435172, 27589530, 27697694, 27705964, 27721502, 27792010, 27979356, 28024995, 28379416, 28760828, 28789904, 29298892, 29320554, 29497399, 29621183, 29790176, 29933008, 29973863, 30123109, 30242618, 30387527, 30388894, 30478329, 30529601, 30696811, 30708351, 30775980, 30877723, 30907317, 31047857, 31060348, 31265107, 31282414, 31456657, 31642777, 31694431, 31784375, 8846237, 9527138, 9641683		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Dementia	Dementia	Pubtator	10805746, 11826152, 12435607, 14685691, 15020716, 15611092, 16495230, 16777844, 16782711, 17023423, 18431250, 18852354, 18940799, 20805522, 20862329, 21163230, 21288907, 21849646, 22312439, 22595371, 22802095, 23515417, 23727082, 24086754, 25088003, 25575135, 25822631, 25900293, 26328896, 26720731, 27061069, 27357347, 27632209, 27901073, 28395086, 29298892, 29320554, 29435558, 29716656, 29750252, 30708351, 30830207, 30909239, 30917570, 31266806, 31362787, 31805990, 31849332, 32161362, 32291284, 32299835, 33061333, 33112398, 33203472, 34031605, 34180956, 34194426, 34209408, 34274950, 34588692, 35120450, 35358831, 35380901, 36258016, 36356475, 36538154, 37330289, 37353565, 37566038, 38232730, 38631765, 40551292, 40617169	Associate	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Dementia	Dementia	CTD_human_DG	11889249, 22300406		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Dementia	Dementia	LHGDN	12476321, 12710929, 12796837, 15178932, 15365985, 15750210, 15765246, 15940384, 16609851, 17021754, 17186252, 17493040, 17662000, 18093153, 18322394, 18587238, 18765933, 18803648		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Dementia	Dementia	Pubtator	39235525	Stimulate	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Dementia	Dementia	HPO_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Dementia	Dementia	CLINVAR_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Dementia of frontal lobe type	Dementia Of Frontal Lobe	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dementia Vascular	Vascular dementia	Pubtator	16191223	Associate	★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	16191223, 22176350, 28839167, 29453935		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	24135712, 29353234, 34024836, 37258256, 40435794	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	29527163, 30121652, 31760473		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	HPO_DG			★☆☆☆☆ Found in Text Mining only
Deuteranomaly	Deuteranomaly	BEFREE	10959034, 11425937, 15036206, 15495240, 15641585, 15792962, 16092076, 17085483, 17174556, 18162161, 18357425, 18854867, 20704554, 26077951, 28271184, 28402959, 29206491, 29926172, 30193298, 30674342, 31327044, 31631020, 7572077, 9630238		★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	32393582	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	24412516, 28609678		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	19659459, 31305320	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	24412516, 28427866, 28609678, 29158110, 30809950, 31799531		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	33832546	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	19659459, 35334221	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	25751624		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	27730513, 28225806		★☆☆☆☆ Found in Text Mining only
Diffuse Cerebral Sclerosis of Schilder	Schilder disease	Pubtator	19255408, 19786698, 29172163	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Cerebral Sclerosis of Schilder	Schilder disease	Pubtator	19299900	Stimulate	★☆☆☆☆ Found in Text Mining only
Disruptive Impulse Control and Conduct Disorders	Disruptive, impulse control, and conduct disorders	Pubtator	39334114	Associate	★☆☆☆☆ Found in Text Mining only
Distal myopathy Nonaka type	Distal myopathy	Pubtator	32756195, 9546349	Associate	★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	12853572, 18430997, 21573099, 22344463, 30902060, 30909239, 32192521, 33070299, 33380426, 35194165, 38631766, 40595720, 40667715	Associate	★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	LHGDN	17914261, 18430997, 18765933		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	18696092, 21157379, 23142525, 27539594, 28144219, 29661714, 30243157		★☆☆☆☆ Found in Text Mining only
Dysarthria	Dysarthria	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dysautonomia	Dysautonomia	BEFREE	12492138		★☆☆☆☆ Found in Text Mining only
Dyscalculia	Dyscalculia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dysgraphia	Dysgraphia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dyslexia	Dyslexia	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dysphasia	Dysphasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dyssomnias	Dyssomnia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	30721423		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	Pubtator	34210823	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	23774255, 29110774, 30696811, 31532186		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	27435091, 27859539, 29634760, 38289539	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy Frontal Lobe	Frontal lobe epilepsy	Pubtator	33568215	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy Temporal Lobe	Temporal lobe epilepsy	Pubtator	19786698, 22284815, 25363208, 27357347, 28319241, 30711674, 31834353, 31870644, 34158384, 39337715	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	30964766		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epithelial ovarian cancer	Ovarian cancer	BEFREE	23631819, 30559148		★☆☆☆☆ Found in Text Mining only
Essential Tremor	Tremor	BEFREE	22911817, 24372973, 27456607		★☆☆☆☆ Found in Text Mining only
Essential Tremor	Essential tremor	Pubtator	22911817, 34363663, 36183486	Associate	★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	CTD_human_DG	12852432, 14517953, 15750215, 20157255, 21715663, 25352456, 27117003		★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	BEFREE	1465214, 22027994, 23998300, 25694106, 28634349		★☆☆☆☆ Found in Text Mining only
Familial Dementia	Dementia	CTD_human_DG	11889249, 22300406		★☆☆☆☆ Found in Text Mining only
Familial Dementia	Dementia	BEFREE	16410051		★☆☆☆☆ Found in Text Mining only
Familial encephalopathy with neuroserpin inclusion bodies	Encephalopathy With Neuroserpin Inclusion Bodies	BEFREE	11914409		★☆☆☆☆ Found in Text Mining only
Familial Juvenile Parkinsonism	Parkinsonian disease	CTD_human_DG	10802785, 19458322		★☆☆☆☆ Found in Text Mining only
Focal Dystonia	Focal dystonia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Folate Malabsorption Hereditary	Hereditary folate malabsorption	Pubtator	25651436	Stimulate	★☆☆☆☆ Found in Text Mining only
Frontotemporal cerebral atrophy	Frontotemporal cerebral atrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	10037497, 10076890, 10202939, 10208578, 10218629, 10219785, 10318930, 10349506, 10359094, 10362789, 10393977, 10412802, 10430438, 10434313, 10446810, 10486204, 10514099, 10530520, 10595944, 10627302, 10637322, 10683298, 10683829, 10688046, 10748133, 10762152, 10771166, 10775534, 10797541, 10802785, 10805089, 10805746, 10821687, 10899436, 10931371, 10940231, 10959034, 10970052, 10983715, 10995239, 11032905, 11089577, 11115852, 11117541, 11117542, 11159174, 11163132, 11164280, 11170176, 11193139, 11193141, 11193178, 11193179, 11207421, 11220736, 11220749, 11239074, 11244285, 11255441, 11259129, 11260802, 11284997, 11303757, 11377973, 11400017, 11433638, 11481705, 11520930, 11556544, 11560926, 11571213, 11578815, 11585254, 11598310, 11601501, 11708997, 11738505, 11741399, 11749044, 11861703, 11898551, 11912108, 11914409, 11921059, 12056929, 12062036, 12111297, 12112206, 12121033, 12151838, 12168561, 12220379, 12231446, 12368474, 12391602, 12414518, 12417659, 12441638, 12444595, 12446970, 12470988, 12476321, 12492138, 12509859, 12565146, 12572916, 12615641, 12672175, 12710929, 12756133, 12796837, 12872001, 12898585, 12938731, 12975285, 14500612, 14503643, 14511120, 14528051, 14755449, 14757934, 15004327, 15036206, 15047590, 15056452, 15056457, 15064135, 15115761, 15122701, 15140937, 15178931, 15178940, 15190058, 15198676, 15270197, 15372253, 15495240, 15548495, 15601849, 15615630, 15615634, 15615637, 15615642, 15615650, 15615814, 15618399, 15664690, 15681835, 15750210, 15765246, 15814784, 15831501, 15878580, 15883319, 15888485, 15904995, 16008820, 16014652, 16092090, 16115884, 16155344, 16157749, 16219306, 16221853, 16222525, 16230627, 16239184, 16240366, 16317255, 16330083, 16410051, 16416390, 16495328, 16503405, 16554120, 16600994, 16691120, 16700555, 16708180, 16862115, 16862116, 16866983, 16879631, 16890190, 16899117, 16914875, 16941655, 16983677, 17059563, 17071927, 17072625, 17080727, 17127334, 17168647, 17186252, 17196872, 17204933, 17224685, 17226741, 17272893, 17297915, 17318302, 17319286, 17386961, 17409229, 17436289, 17464468, 17493040, 17517691, 17522386, 17526496, 17596718, 17639429, 17659186, 17715352, 17721707, 17764851, 17923640, 17932487, 17976991, 18066559, 18093153, 18162161, 18307268, 18314228, 18322368, 18322394, 18357425, 18413467, 18431510, 18490011, 18625456, 18678901, 18703462, 18852354, 18854867, 18951953, 19263483, 19304664, 19401603, 19491104, 19498037, 19659892, 19674978, 19766248, 19768372, 19967412, 20178834, 20369906, 20377816, 20413880, 20452812, 20498436, 20561037, 20634582, 20668182, 20704554, 20708332, 20711061, 20858961, 20869593, 20971753, 21176711, 21212632, 21295377, 21343707, 21603977, 21681797, 21753165, 21753175, 21785996, 21986680, 22102449, 22169201, 22280354, 22366795, 22411238, 22461630, 22527778, 22556362, 22595371, 22817715, 22862741, 23001634, 23043292, 23105105, 23121543, 23518664, 23609018, 23721814, 23774255, 23885714, 23927914, 23998300, 24041972, 24050961, 24086739, 24278307, 24292008, 24387985, 24448233, 24503275, 24627328, 24861427, 24998994, 25038828, 25115866, 25153994, 25377499, 25428250, 25471585, 25495175, 25556536, 25604855, 25683866, 25694106, 25765123, 25794683, 25853458, 25862286, 26086902, 26136155, 26143746, 26159191, 26373282, 26444794, 26473392, 26635213, 26756400, 26852117, 26977398, 26990251, 27082848, 27311648, 27345788, 27345791, 27358337, 27435172, 27439681, 27521751, 27529406, 27539594, 27594586, 27632209, 27663563, 27789409, 27789411, 27802239, 27855167, 27859539, 27899424, 27905268, 27934586, 27975259, 27975264, 28130473, 28233851, 28256506, 28271184, 28402959, 28462717, 28484365, 28594853, 28839167, 28848086, 28916533, 28978354, 29138281, 29206491, 29215752, 29226866, 29253099, 29259137, 29370822, 29376859, 29556602, 29568692, 29578490, 29621183, 29716656, 29729314, 29729423, 29731706, 29852407, 29889066, 29914030, 29914543, 29930232, 29951497, 30010122, 30036493, 30050413, 30057263, 30094168, 30103325, 30353822, 30479844, 30508042, 30517788, 30546007, 30562452, 30599077, 30650353, 30696811, 30704514, 30742061, 30773680, 30793898, 30827922, 30893702, 30905766, 31027853, 31176718, 31366728, 31402617, 31537395, 31543469, 31640778, 31653695, 31696638, 31715291, 31810826, 9392579, 9636220, 9641683, 9736786, 9786340, 9789048, 9799091, 9811325, 9824291, 9836646, 9877531, 9973279		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	10037497, 10209184, 10214944, 10318930, 10359094, 10393977, 10561502, 10805746, 11078890, 11159174, 11571213, 11861703, 11906000, 12023276, 12198126, 12414518, 12649279, 12756133, 14511120, 14757934, 15190058, 15489396, 15548495, 15611092, 15618399, 16136847, 16495328, 16782711, 16943417, 16945149, 17522386, 17526496, 17723255, 17727636, 18065436, 18322394, 18678901, 18725924, 18800011, 18852354, 18854867, 18940799, 19001166, 19010781, 19494431, 19884571, 20561037, 21212632, 21498513, 21607722, 21753165, 21849646, 21892619, 22009441, 22366795, 22367382, 22556362, 22595371, 22844088, 22862741, 23043292, 23121543, 23325909, 23518664, 23718879, 23759146, 23951348, 24041972, 24086739, 24135712, 24252534, 24292008, 24510641, 24709683, 24943344, 24994843, 25115866, 25662776, 25683866, 25765123, 25926130, 26108573, 26136155, 26143746, 26295349, 26297556, 26338813, 26373282, 26444794, 26583316, 26682693, 26720731, 26990251, 27036121, 27082848, 27345788, 27345789, 27345791, 27529406, 27581216, 27594585, 27594586, 27632209, 27789409, 27789411, 27855167, 27859539, 27899424, 27905268, 27934586, 28130473, 28256506, 28264768, 28268100, 28271184, 28319892, 28460069, 28529873, 28594853, 29020091, 29113604, 29172163, 29228211, 29253099, 29259137, 29353234, 29440230, 29476165, 29514947, 29627938, 29716656, 29729314, 29793546, 30036493, 30094168, 30111356, 30458895, 30467822, 30508042, 30517788, 30664870, 30704514, 30711674, 30773680, 30847369, 30847466, 30981993, 30996196, 31315971, 31358058, 31362787, 31402617, 31433871, 31542321, 31542807, 31543469, 31578281, 31636026, 31640778, 31653695, 31700063, 31701893, 31810826, 31870644, 31914226, 31999351, 32143137, 32299835, 32310161, 32364710, 32727073, 32843152, 32977230, 33112398, 33122395, 33199422, 33247623, 33404617, 33427744, 33772783, 33857770, 33895632, 34057756, 34158384, 34274155, 34274950, 34314701, 34342183, 34353857, 34366349, 34416145, 34426604, 34426645, 34561610, 34633446, 34664612, 34743360, 35051675, 35063084, 35120450, 35348856, 35410286, 35483895, 35509074, 35731895, 35799292, 35820647, 35948443, 35964197, 35985329, 36045450, 36171642, 36217158, 36329418, 36385202, 36474176, 36499048, 36604747, 36799407, 36895129, 37054899, 37175990, 37182866, 37349319, 37351604, 37563653, 37703311, 37746582, 37852393, 38040703, 38128829, 38174587, 38286213, 38605589, 39284109, 39510192, 39527773, 39658879, 39994734, 40044789, 40673371, 40677151, 40713844, 9636220, 9789048, 9811325, 9824291, 9973279, 9989582	Associate	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Frontotemporal dementia	Frontotemporal dementia	UNIPROT_DG	10208578, 10214944, 10374757, 10489057, 10553987, 10802785, 11071507, 11117541, 11278002, 11585254, 11889249, 11906000, 11921059, 12473774, 12509859, 14517953, 15883319, 16240366, 26086902, 9629852, 9641683, 9736786, 9789048, 9973279		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Frontotemporal dementia	Frontotemporal dementia	CLINVAR_DG	10412802, 10489057, 11708988, 11756436, 11912108, 11971081, 14568818, 16219306, 17715352, 17923640, 19365643, 19498037, 19766248, 19786698, 20045477, 22022446, 22723997, 23680655, 25592136, 26143746, 26220942, 26269332, 26373282, 26519432, 27082848, 27439681, 28097206, 9641683		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Frontotemporal dementia	Frontotemporal dementia	CTD_human_DG	10802785, 11117542, 11912108, 16495328, 9641683, 9789048		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	30698757	Stimulate	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Frontotemporal dementia	Frontotemporal dementia	HPO_DG			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Frontotemporal dementia	Frontotemporal dementia	GENOMICS_ENGLAND_DG			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Frontotemporal Lobar Degeneration	Frontotemporal dementia	BEFREE	12710929, 14720172, 16421115, 16495329, 16552612, 16866983, 16987883, 17707586, 17721707, 17805587, 18066559, 18177439, 18357425, 19091059, 19101631, 19365643, 19940479, 20369906, 20412296, 20634582, 20838030, 20938042, 21073671, 21222603, 21311163, 21558644, 21603977, 21698753, 21753175, 21860090, 21908872, 21943955, 22177996, 22411238, 22699846, 22817714, 22818528, 22862741, 23053136, 23338682, 24011980, 24018212, 24081456, 24861427, 25549971, 25574752, 26041339, 26463677, 26861289, 27009575, 27435172, 27721502, 28803444, 28980860, 29253099, 29578490, 29729314, 29790198, 29794074, 30590647, 31599329, 31631020, 31640778, 31667556		★☆☆☆☆ Found in Text Mining only
Gerstmann-Straussler-Scheinker Disease	Gerstmann-Straussler-Scheinker syndrome	BEFREE	9285466		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	29059309		★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	37201334	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	31311947, 35229396, 37894731	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	23020756	Associate	★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	16906163, 22950410		★☆☆☆☆ Found in Text Mining only
Grammar-specific speech disorder	Grammar-specific speech disorder	HPO_DG			★☆☆☆☆ Found in Text Mining only
Gray Platelet Syndrome	Graves ophthalmopathy	Pubtator	20045477, 30753379, 33622418	Associate	★☆☆☆☆ Found in Text Mining only
Hallucinations	Hallucinations	BEFREE	24011980, 25306292		★☆☆☆☆ Found in Text Mining only
Hearing Loss	Hearing loss	Pubtator	36356475	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	29082658, 33093220, 34002449, 34314701, 35483895, 38174587	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	32842621	Inhibit	★☆☆☆☆ Found in Text Mining only
Heart Failure Diastolic	Heart failure	Pubtator	25363208	Associate	★☆☆☆☆ Found in Text Mining only
Hemimegalencephaly	Hemimegalencephaly	Pubtator	23319189	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Leukoencephalopathy with Spheroids	Hereditary Diffuse Leukoencephalopathy With Spheroids	BEFREE	10202939		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	10924769, 14720172, 15538967, 25953777, 30290707, 31572186		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	25953777, 27344050, 27651306, 28241046, 29474427, 30573872, 31358058, 38544341, 40256911	Associate	★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	Pubtator	28212403	Stimulate	★☆☆☆☆ Found in Text Mining only
Hydrocephalus Normal Pressure	Normal pressure hydrocephalus	Pubtator	31849332	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	28427866, 29126968, 30081082		★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	30003389		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	28427866		★☆☆☆☆ Found in Text Mining only
Hyperkinesis	Hyperkinesia	Pubtator	35246269	Associate	★☆☆☆☆ Found in Text Mining only
Hypotension Orthostatic	Orthostatic hypotension	Pubtator	32767721	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	29215599	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	28123494, 29171431, 30821182		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	12196665, 14523627, 14694044, 15601849, 16099324, 16219306, 17683088, 19812213, 19879019, 22039833, 22169201, 22344634, 22531419, 22802095, 23121543, 23390180, 23781007, 24757111, 24880087, 24905038, 25002573, 25573097, 25953777, 26758828, 26991855, 27061069, 27073221, 27358337, 27401747, 27486879, 27697694, 27861127, 27934563, 27955995, 28196395, 28281308, 28367114, 28485728, 28523532, 28533515, 28769761, 28827321, 29107845, 29207020, 29471055, 29484146, 29512077, 29627938, 29899731, 29936149, 30223691, 30273594, 30355322, 30599271, 30695686, 30728442, 30810314, 31044219, 31099321, 31166546, 31172290, 31325514, 31358058, 31427644, 31439664, 31695992, 31724513		★☆☆☆☆ Found in Text Mining only
Inclusion Body Myopathy, Sporadic	Inclusion body myopathy	BEFREE	24462217, 8291607		★☆☆☆☆ Found in Text Mining only
Inclusion Body Myositis (disorder)	Inclusion Body Myositis	BEFREE	16788822, 27939356		★☆☆☆☆ Found in Text Mining only
Insomnia Fatal Familial	Insomnia	Pubtator	34487324	Stimulate	★☆☆☆☆ Found in Text Mining only
Insomnia Fatal Familial	Insomnia	Pubtator	39716111	Associate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	22536436, 27079723, 33267804, 33832546	Associate	★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	26824039		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	17707586, 22419166, 22678764, 22817714		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	20395263	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	31841442		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	31950334	Associate	★☆☆☆☆ Found in Text Mining only
Lafora Disease	Lafora Disease	BEFREE	26333800, 31362787		★☆☆☆☆ Found in Text Mining only
Language Disorders	Language development disorders	Pubtator	18322394, 31870644, 31999351, 37348248	Associate	★☆☆☆☆ Found in Text Mining only
Language Disorders	Language Disorders	BEFREE	30549411		★☆☆☆☆ Found in Text Mining only
Language Disorders	Language Disorders	HPO_DG			★☆☆☆☆ Found in Text Mining only
Large cell carcinoma of lung	Lung Carcinoma	BEFREE	31496800		★☆☆☆☆ Found in Text Mining only
Learning Disabilities	Learning Disorders	BEFREE	16906163, 22950410		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Learning Disabilities	Learning Disorders	CTD_human_DG	22430071, 24556215		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Learning Disabilities	Learning disorders	Pubtator	22950410	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Learning Disorders	Learning Disorders	CTD_human_DG	22430071, 24556215		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Learning Disturbance	Learning Disorders	CTD_human_DG	22430071, 24556215		★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	7943169	Associate	★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	19812213, 22819391, 24226269, 25575135, 25604855, 26333800, 27287057, 28634349, 30674342, 31234228, 31311013, 7992850		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy body disease	Pubtator	24086518, 25575135, 26333800, 26756745, 26923020, 28077166, 28269775, 28395086, 30448004, 31165862, 31234228, 32561678, 32989106, 33631469, 34308904, 34514546, 36443011, 39658879, 9811326	Associate	★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy body disease	Pubtator	32842621	Inhibit	★☆☆☆☆ Found in Text Mining only
Limb apraxia	Limb apraxia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	30720194		★☆☆☆☆ Found in Text Mining only
Long QT Syndrome	Long qt syndrome	Pubtator	27390944	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	GWASCAT_DG	23583980		★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	GWASDB_DG	23583980		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	GWASCAT_DG	29942085		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malformations of Cortical Development	Cortical development malformation	Pubtator	31200149, 34373896	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	30535461		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15914550, 18668363, 20228842, 20579400, 21062914, 21679412, 26408675, 27221882, 28133523, 29441192, 30074401, 30535461		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	30394813		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	30823906		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	23423488, 24722794		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28035936, 29794074, 30823906		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	28715472		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	29441192		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	30535461		★☆☆☆☆ Found in Text Mining only
Memory Disorders	Memory Disorders	CTD_human_DG	12368474, 22430071, 24556215, 29203278, 29860433		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Memory Disorders	Memory disorders	Pubtator	20862329, 22911757, 23121543, 25960448, 27357347, 30563962, 30992433, 31653847, 32367269, 34158479, 35008592, 35348856, 35670275, 35917404, 36707904, 38134678	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Memory Disorders	Memory disorders	Pubtator	33857770, 39670385	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Meningioma	Meningioma	BEFREE	28887599		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	29527163, 30121652, 31760473		★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	17707586, 22817714		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	31642932	Associate	★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	12196665, 14699432, 15148149, 16037976, 20157246, 20930301, 23064258, 25344117, 25936935, 26159191, 28839167, 29039020, 29125485, 29141977, 30207231, 30747516, 31159754, 31440157		★☆☆☆☆ Found in Text Mining only
Mitochondrial complex I deficiency	Mitochondrial complex deficiency	Pubtator	25402454	Inhibit	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	22424094, 26198711, 30683981, 31536662, 34779076, 37408218	Associate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	27594585, 36982371	Stimulate	★☆☆☆☆ Found in Text Mining only
Moderate intellectual disability	Mental retardation	BEFREE	22678764		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	GWASCAT_DG	29942085		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood disorder	Pubtator	32769115, 37806671	Associate	★☆☆☆☆ Found in Text Mining only
Motor neuron atrophy	Motor neuron atrophy	BEFREE	20498436		★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor Neuron Disease	BEFREE	14503643, 15883319, 24861427, 25853458, 30893702, 31027853, 31696638		★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor neuron disease	Pubtator	18800011, 19884572, 27036121, 34274155	Associate	★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease, Lower	Motor Neuron Disease	BEFREE	30893702		★☆☆☆☆ Found in Text Mining only
Movement Disorders	Movement Disorders	BEFREE	10983715, 11193179, 11470966, 12796837, 21807765, 22817717, 25900293		★☆☆☆☆ Found in Text Mining only
Movement Disorders	Movement disorder	Pubtator	25900293, 31234228	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	LHGDN	15083285		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	23911736, 26576485, 27697018, 27816592, 31733529		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	36221144	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	31733529		★☆☆☆☆ Found in Text Mining only
Multiple System Atrophy	Multiple system atrophy	Pubtator	26333800, 27374978, 27629089, 28077166, 34255887, 35485527	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Muscular Atrophy Spinal	Spinal muscular atrophy	Pubtator	31123861	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	24222227	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Diseases, Secondary	Myocardial Diseases	CTD_human_DG	29068127		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	LHGDN	18382889		★☆☆☆☆ Found in Text Mining only
Myositis Inclusion Body	Myositis	Pubtator	14695312, 16441512, 24462217, 25978849, 32756195, 8577761	Associate	★☆☆☆☆ Found in Text Mining only
Myotonic Disorders	Myotonic Disorders	BEFREE	15215218		★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	BEFREE	11590131, 21439371, 24440524		★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	16487687, 19166838, 21439371, 24440524, 25702800, 33955002	Associate	★☆☆☆☆ Found in Text Mining only
Nail-Patella Syndrome	Nail-Patella Syndrome	BEFREE	30010122		★☆☆☆☆ Found in Text Mining only
Narcolepsy type 1	Narcolepsy	BEFREE	30387527		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	22935999		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17010609, 22607768, 23942071		★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	21398043, 24346801, 25535399, 25574752, 27115769, 30136084	Associate	★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	10619631, 11159174, 11556544, 11578871, 11710889, 15615637, 29359764, 29915575, 30001207, 30149687, 30535461, 31073393, 31087810		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10683829, 11738505, 15120619, 19461118, 20377816, 21320871, 23635409, 23943618, 26032516, 28294523, 29173031, 29541355, 29705343, 29932870, 30068273, 30248427, 30394813, 30468808, 31424392, 9498223, 9614189, 9716264		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	18239850, 18672021, 20930284, 21127069, 27266855, 27548710, 30124450, 30394813, 32427887, 33934221, 36830589, 8468346, 8919303	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	10037497, 10209184, 10214944, 10737634, 12032355, 12358741, 12756133, 14695329, 15020716, 15190058, 15611092, 16464864, 16495230, 16782711, 16943417, 17357082, 17428800, 17512525, 17602795, 17727636, 18315566, 18661559, 18803694, 18852354, 18854867, 18940799, 19010781, 20298971, 20930284, 20974297, 21085657, 2119143, 21333649, 21397051, 21498513, 21755018, 21881826, 22009441, 22027014, 22039833, 22366796, 22539343, 22595371, 22677170, 22723018, 22769591, 22802095, 22862741, 22976236, 23371364, 23515417, 23518664, 23696636, 24032460, 24086518, 24225352, 24319659, 24453187, 24533944, 24656848, 24779391, 25168738, 25175602, 25219293, 25822631, 25953777, 26165593, 26410307, 26583316, 26655600, 27013866, 27099072, 27129267, 27344050, 27374978, 27435091, 27466319, 27697694, 27802219, 27855167, 28006031, 28044308, 28087578, 28189700, 28241163, 28319892, 28575131, 28689993, 28974731, 28986472, 29053874, 29105977, 29164798, 29402847, 29634760, 29684271, 29716656, 29729314, 29794074, 30016411, 30021611, 30024984, 30036493, 30238240, 30242125, 30276465, 30394813, 30448004, 30477432, 30630532, 30664870, 30720432, 30773680, 31017923, 31182772, 31266806, 31291322, 31306137, 31346240, 31350322, 31358058, 31358628, 31484787, 31578281, 31640778, 31779690, 31825500, 31836670, 32097865, 32161412, 32205467, 32290864, 32291284, 32364710, 32391858, 32427887, 32485097, 32580499, 32808011, 32829096, 33097630, 33408150, 33496017, 33571490, 33804213, 33883011, 33910019, 34128081, 34158479, 34195681, 34298918, 34314701, 34416145, 34418401, 34426645, 34514546, 34586830, 34617306, 34656563, 34696502, 34846537, 34965173, 35063084, 35135879, 35172755, 35179198, 35218773, 35358831, 35819518, 35985329, 36066634, 36162501, 36267464, 36443011, 36494352, 36563857, 36630781, 36948206, 36959205, 36982371, 37000265, 37075845, 37131250, 37353565, 37408218, 37730697, 37852393, 37930695, 38041405, 38232730, 38408247, 38544341, 39343862, 40158290, 40411302, 40673371, 9636220, 9789048	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	35008438	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	10037497, 10076890, 10209184, 10218629, 10320789, 10482263, 10517507, 10621897, 10959034, 10983715, 11193179, 11207421, 11284997, 11377973, 11487626, 11520930, 11571213, 11590131, 11861703, 11898551, 11930135, 12062036, 12151838, 12168561, 12220379, 12358741, 12410385, 12588928, 14528051, 14602710, 14612456, 14624025, 14627651, 14678771, 14690409, 15033802, 15036206, 15056452, 15115761, 15140937, 15372253, 15495240, 15601849, 15615629, 15615637, 15615641, 15671021, 15890012, 15918074, 15930395, 15950767, 15986501, 16317255, 16410051, 16416390, 16554120, 16899117, 16958643, 16987883, 17017867, 17080727, 17085483, 17127334, 17309878, 17357082, 17416103, 17517623, 17555970, 17590238, 17727636, 18291106, 18431510, 18448228, 18509094, 18854867, 18992725, 19352323, 19450659, 19498037, 19625747, 19826005, 19879020, 19940479, 20060898, 20110614, 20159774, 20160454, 20213269, 20561037, 20658990, 20668182, 20704554, 20858961, 20974297, 21063069, 21343707, 21397051, 21403021, 21705366, 21785996, 21876254, 21892619, 22027014, 22027994, 22176890, 22206005, 22272617, 22292029, 22351109, 22461630, 22556362, 22611162, 22723018, 22769591, 22817717, 22818528, 22911817, 22917148, 22975846, 23211594, 23587140, 23911736, 23999428, 24018212, 24050961, 24226269, 24252572, 24309291, 24372973, 24464041, 24524897, 24556215, 24623856, 24627328, 24754737, 24779391, 24825901, 24887264, 25153994, 25168738, 25205109, 25284680, 25402454, 25574752, 25804954, 25862286, 25863528, 25878277, 25881209, 25953777, 26159201, 26276810, 26298468, 26362250, 26363795, 26373282, 26502813, 26550830, 26576216, 26581847, 26632684, 26701291, 26756400, 26888634, 26944285, 26969684, 27000837, 27222125, 27287057, 27374978, 27425887, 27458716, 27479154, 27705964, 27789409, 27789411, 27797445, 27855167, 27934586, 27940600, 27975243, 27975254, 28006031, 28049840, 28077166, 28088900, 28233851, 28281838, 28303942, 28319892, 28402959, 28413156, 28455089, 28456717, 28554859, 28575131, 28600952, 28610892, 28634349, 28689993, 28711868, 28751068, 28760828, 28765091, 28769761, 28821400, 28839167, 28869476, 28882308, 28882310, 28882311, 28882312, 28882313, 28921979, 28934963, 28972160, 28978354, 28982592, 28983098, 28992057, 29037207, 29042207, 29042514, 29106033, 29121589, 29126071, 29138281, 29163138, 29171999, 29187256, 29226866, 29238289, 29254093, 29273222, 29375461, 29436735, 29493301, 29495325, 29509687, 29512077, 29540553, 29556602, 29584657, 29634760, 29634991, 29686391, 29730992, 29772786, 29790176, 29793417, 29878234, 29886548, 29894752, 29933008, 29936232, 29951497, 30024984, 30032423, 30038280, 30126037, 30134156, 30137327, 30172839, 30223396, 30242125, 30254002, 30261006, 30276465, 30314799, 30333786, 30355631, 30386294, 30394813, 30411771, 30450030, 30466464, 30479844, 30529601, 30531722, 30550860, 30562452, 30584140, 30590647, 30619849, 30696811, 30720432, 30767082, 30769286, 30804241, 30809933, 30814358, 30847469, 30874605, 30905766, 30907729, 30925618, 30950394, 31013607, 31122495, 31152932, 31169189, 31174206, 31176718, 31178717, 31238088, 31248178, 31306814, 31324714, 31327044, 31339297, 31341529, 31358058, 31366728, 31391090, 31423763, 31427644, 31436053, 31439664, 31481160, 31521630, 31522011, 31524157, 31585367, 31642777, 31715291, 31780921, 31795012, 31821364, 9636220, 9786340, 9789048, 9836646		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodegenerative Disorders	Neurodegenerative Disorders	LHGDN	12112079, 12714745, 15228592, 16464864, 17085483, 17373874, 17555970, 18561034, 18662339		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodegenerative Disorders	Neurodegenerative Disorders	CTD_human_DG	22430071, 9789048		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	30550860		★☆☆☆☆ Found in Text Mining only
Neuromuscular dysphagia	Neuromuscular dysphagia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	25535399, 29117336		★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	19074461, 22935999		★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C1	Sphingomyelinase deficiency	BEFREE	23023945		★☆☆☆☆ Found in Text Mining only
Night blindness congenital stationary	Night blindness, congenital stationary	Pubtator	25912737, 26791227	Associate	★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	27714074, 31496800		★☆☆☆☆ Found in Text Mining only
NONAKA MYOPATHY	Inclusion body myopathy	BEFREE	8291607		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	24103379, 9629852		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	29115457	Associate	★☆☆☆☆ Found in Text Mining only
Oculomotor apraxia	Oculomotor apraxia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Oculovestibuloauditory syndrome	Oculovestibuloauditory Syndrome	HPO_DG			★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	17404087, 20579400		★☆☆☆☆ Found in Text Mining only
Ophthalmoplegia, Progressive Supranuclear	Progressive supranuclear ophthalmoplegia	CTD_human_DG	12325083, 19458322, 21685912, 25402454		★☆☆☆☆ Found in Text Mining only
Optic Atrophy, Hereditary, Leber	Hereditary Leber Optic Atrophy	BEFREE	21397051		★☆☆☆☆ Found in Text Mining only
Osteoarthritis of hip	Osteoarthritis Of Hip	GWASCAT_DG	30664745		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis of hip	Osteoarthritis Of Hip	CTD_human_DG	30664745		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis	Osteoporosis	Pubtator	28340083, 32155994	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	30394813		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	25658796	Associate	★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic disorder	Pubtator	29353234	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	10507561, 10665497, 11260802, 11377973, 11391737, 11706972, 11710889, 11958849, 12231446, 14600827, 14991810, 15201350, 15297935, 15538967, 15627775, 15732111, 15792962, 16876320, 16899997, 16987883, 17085483, 17192721, 17514749, 17522092, 17555970, 17637803, 17683088, 18162161, 18210157, 18509094, 18785640, 18854867, 18930114, 18985386, 19156451, 19450659, 19558713, 19573950, 19812213, 19879020, 19912324, 19915576, 20070850, 20498436, 20547614, 20678581, 20683486, 20938043, 20951764, 21058943, 21063069, 21159074, 21248740, 21292315, 21344240, 21391235, 21403021, 21412835, 21425343, 21812969, 21816655, 21898123, 22023810, 22027014, 22104010, 22206005, 22221882, 22292029, 22344634, 22556362, 22786590, 22802095, 22911817, 23001634, 23238920, 23939307, 23962496, 24253235, 24372973, 24375821, 24514572, 24559644, 24779391, 25080285, 25178429, 25305495, 25577413, 25604855, 25687773, 25804954, 25960998, 26209472, 26303052, 26444794, 26601739, 26776090, 26991855, 27061069, 27094865, 27098667, 27115672, 27120258, 27336847, 27338814, 27458716, 27539594, 27600680, 27697694, 27899424, 28202670, 28246183, 28257128, 28402959, 28634349, 28689993, 28839167, 29029963, 29084565, 29466944, 29627019, 29636460, 29669022, 29756641, 29887346, 29899731, 29914030, 30074401, 30333786, 30339920, 30353822, 30824768, 30877973, 31085590, 31214163		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	11710889, 14966169, 15792962, 17514749, 18509094, 18854867, 18985386, 19558713, 19912324, 20070850, 20127702, 20599975, 20683486, 21058943, 21127069, 21248740, 21412835, 21425343, 21613474, 21812969, 21816655, 21875422, 22023810, 22027014, 22104010, 22135858, 22170881, 22221882, 22556362, 22595371, 22786590, 22802095, 22950410, 23071545, 23507417, 23644819, 23939307, 23962496, 24086518, 24375821, 24514572, 24779391, 25003242, 25080285, 25168738, 25178429, 25577413, 25596881, 25687773, 25899925, 25960998, 26497684, 26601739, 27061069, 27098667, 27287230, 27299523, 27393345, 27458716, 27697694, 27709663, 27798653, 27899424, 28077166, 28575131, 28586827, 28689993, 29084565, 29466944, 29756641, 30824768, 31234228, 31504236, 31660654, 31700063, 31733655, 32291284, 32767721, 32829096, 33106633, 33832546, 33947435, 35106798, 35179198, 35418463, 35485527, 35841044, 36262874, 36870058, 36906636, 37015993, 37201334, 37673381, 37898823, 38254936, 38605589, 40363838, 40435794, 40488901	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	LHGDN	11958849, 17192721, 17514749, 17637803, 17683088, 18509094		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	CTD_human_DG	19915575, 20711177		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	GWASDB_DG	19915575, 21044948, 21738487, 22438815, 24842889		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	GWASCAT_DG	21044948, 25064009, 28892059		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	27288043, 27336847	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease 12	Parkinson disease	Pubtator	20629132	Associate	★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE 2, AUTOSOMAL RECESSIVE JUVENILE	Parkinson Disease	CTD_human_DG	10802785, 19458322		★☆☆☆☆ Found in Text Mining only
Parkinson Disease Secondary	Secondary parkinson disease	Pubtator	10214944, 18509094, 20127702, 20629132, 21892619, 22595371, 22623900, 23727082, 24135712, 24514572, 24842889, 26295349, 26426266, 27458716, 27529406, 28268100, 29716656, 29877269, 30373672, 30517788, 31234228, 31870644, 31999351, 32291284, 32989106, 33247623, 38605589, 40044789	Associate	★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	11710889, 12932819, 16860562, 16899997, 24253235, 29436735		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	GENOMICS_ENGLAND_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	CTD_human_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	CLINVAR_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Parkinsonian Disorders	Parkinson Disease	BEFREE	10329720, 10349506, 10393977, 10412802, 10430438, 10495033, 10530520, 10553987, 10595944, 10683298, 10762152, 10802785, 10805089, 10931371, 10940231, 10970052, 11032905, 11117541, 11163132, 11207421, 11433638, 11456301, 11585254, 11741399, 11891833, 12056929, 12111297, 12470988, 12492138, 12672175, 12796837, 12899197, 12938731, 14502653, 14528051, 14595646, 15056452, 15658002, 15765246, 15814784, 15888485, 15977985, 16014652, 16157749, 16240366, 16862115, 17168647, 17318302, 17683088, 17715352, 18509094, 18951953, 19364361, 19898260, 20187245, 20858961, 21063069, 21176711, 21681797, 21892619, 22169201, 22595371, 23121543, 23254636, 24292008, 24514572, 24559644, 24998994, 25495175, 25853458, 26295349, 26891767, 27311648, 27458716, 27905268, 28789904, 29084565, 29253099, 29716656, 30333786, 30517788, 30773680, 30905766, 31027853, 31070772, 31085590, 31206007, 31234228, 9736786, 9789048, 9811325, 9877531		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinsonian Disorders	Parkinson Disease	CTD_human_DG	10802785, 19458322		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinsonian Disorders	Parkinson Disease	LHGDN	12492138, 12796837, 15178932, 16678934, 17493040, 18093153, 18307268, 18322394, 18561034		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinsonian Disorders	Parkinson disease	Pubtator	25899925, 32854784	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinsonian Disorders	Parkinson Disease	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinsonism, Juvenile	Parkinsonian disease	CTD_human_DG	10802785, 19458322		★☆☆☆☆ Found in Text Mining only
Paroxysmal atrial fibrillation	Paroxysmal atrial fibrillation	CTD_human_DG	29892015		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	29069985		★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	29069985		★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	16899997, 20547614		★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	BEFREE	10076890, 10208578, 10218629, 10219785, 10349506, 10359094, 10362789, 10393977, 10412802, 10434313, 10446810, 10486204, 10514099, 10517507, 10530520, 10595944, 10637322, 10683298, 10683829, 10688046, 10762152, 10771166, 10802785, 10805089, 10821687, 10899436, 10924769, 10959034, 10965792, 10983715, 10995239, 11032905, 11089577, 11115852, 11117541, 11117542, 11159174, 11163132, 11166961, 11193141, 11193177, 11193178, 11193179, 11207421, 11220749, 11244285, 11260802, 11377973, 11400017, 11433638, 11481705, 11520930, 11556544, 11560926, 11585254, 11601501, 11708997, 11738505, 11741399, 11749044, 11861703, 11898551, 11912108, 11914409, 11921059, 12111297, 12112079, 12121033, 12151838, 12177383, 12368474, 12391602, 12417659, 12441638, 12470988, 12492138, 12509859, 12572916, 12615641, 12710929, 12787326, 12796837, 12898585, 12938731, 14503643, 14511120, 14528051, 14757934, 15004327, 15036206, 15047590, 15064135, 15178931, 15372253, 15615630, 15615642, 15615650, 15615814, 15658002, 15664690, 15681835, 15750210, 15765246, 15814784, 15892300, 15904995, 15977985, 16008820, 16014652, 16092090, 16219306, 16240366, 16242644, 16410051, 16416390, 16503405, 16866983, 16890190, 16899117, 17059563, 17071927, 17072625, 17080727, 17186252, 17196872, 17204933, 17224685, 17318302, 17319286, 17386961, 17409229, 17493040, 17526496, 17596718, 17639429, 17715352, 17923640, 17932487, 18066559, 18093153, 18314228, 18322394, 18490011, 18625456, 18678901, 18951953, 19304664, 19491104, 19768372, 20178834, 20360166, 20377816, 20498436, 20561037, 20634582, 20668182, 20711061, 20858961, 20869593, 21176711, 21212632, 21242493, 21295377, 21343707, 21681797, 21785996, 21908872, 22102449, 22169201, 22366795, 22461630, 22527778, 22556362, 22595371, 23121543, 23518664, 23927914, 23998300, 24041972, 24086739, 24278307, 24292008, 24448233, 24503275, 25115866, 25153994, 25495175, 25556536, 25604855, 25853458, 25862286, 26086902, 26426266, 26473392, 26635213, 26756400, 26861289, 27082848, 27345788, 27345791, 27539594, 27594586, 27663563, 27789409, 27789411, 27802239, 27859539, 27905268, 27934586, 27975259, 28484365, 28978354, 29138281, 29215752, 29253099, 29716656, 29729314, 29729423, 29914030, 30036493, 30158706, 30193298, 30508042, 30517788, 30773680, 30893702, 30905766, 31402617, 31537395, 31640778, 31715291, 31810826, 9641683, 9736786, 9786340, 9799091, 9811325, 9824291, 9836646, 9877531, 9973279		★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	UNIPROT_DG	10604746, 11089577, 11117542, 11601501, 11891833		★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	CTD_human_DG	10604746, 11117542, 11601501, 9641683		★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	LHGDN	12112079		★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Pineal Gland Neoplasm	Pineal Gland Neoplasm	BEFREE	20418777		★☆☆☆☆ Found in Text Mining only
Pleocytosis	CSF pleocytosis	BEFREE	30721423		★☆☆☆☆ Found in Text Mining only
PNEUMOTHORAX, PRIMARY SPONTANEOUS	Pneumothorax	BEFREE	12847166, 18785640, 19912324		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	10076900, 10208578, 10329720, 10374757, 10412802, 10430438, 10446810, 10465706, 10683298, 10924769, 10983715, 11810290, 11891833, 11921059, 12056930, 12872001, 12876142, 14568818, 15036206, 15056452, 15178940, 15596617, 15671021, 16495230, 16899997, 17683088, 17715352, 17954934, 18284428, 18953105, 19503072, 19812213, 20178834, 20187245, 20522014, 20668182, 20852909, 20930301, 21403021, 21530001, 21555888, 21593513, 21694453, 21785996, 21849646, 22419166, 22802095, 23519520, 23727082, 24150109, 24757111, 24905038, 25025689, 25575135, 25900293, 26143746, 26159191, 26295349, 26444794, 26758828, 27061069, 27435172, 27589530, 27697694, 27705964, 27721502, 27792010, 27979356, 28024995, 28379416, 28789904, 29320554, 29497399, 29790176, 29933008, 29973863, 30123109, 30242618, 30387527, 30388894, 30478329, 30696811, 30708351, 30775980, 30877723, 30907317, 31047857, 31060348, 31265107, 31282414, 31642777, 31694431, 31784375, 8846237, 9527138, 9641683		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	CTD_human_DG	12852432, 14517953, 15750215, 20157255, 21715663, 25352456, 27117003		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	GWASCAT_DG	22961000		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Primary biliary cirrhosis	Biliary Cirrhosis	GWASDB_DG	22961000		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Primary Progressive Aphasia (disorder)	Aphasia	BEFREE	12629248, 16222525, 25765123, 30599136, 31350322, 31696638		★☆☆☆☆ Found in Text Mining only
Primary Progressive Nonfluent Aphasia	Nonfluent Aphasia	BEFREE	17712160, 18357425, 21343707, 27311648, 27439681, 28100023		★☆☆☆☆ Found in Text Mining only
Primary Progressive Nonfluent Aphasia	Nonfluent Aphasia	ORPHANET_DG	23597030		★☆☆☆☆ Found in Text Mining only
Prion Diseases	Prion disease	Pubtator	21416485, 27893164, 31953922, 33883011, 35288744, 36221144, 36952379	Associate	★☆☆☆☆ Found in Text Mining only
Prion Diseases	Prion disease	Pubtator	33674752, 34035398	Stimulate	★☆☆☆☆ Found in Text Mining only
Progressive non-fluent aphasia	Progressive Non-Fluent Aphasia	Orphanet			★☆☆☆☆ Found in Text Mining only
Progressive supranuclear palsy	Progressive Supranuclear Palsy	BEFREE	10072441, 10209184, 10482263, 10495033, 10522876, 10530520, 10534245, 10580705, 10665497, 10674623, 10771166, 10787116, 10959034, 10965792, 10983715, 11193178, 11220749, 11425937, 11445645, 11520930, 11578815, 11861703, 11960887, 12056929, 12062036, 12112206, 12151839, 12177383, 12231446, 12465088, 12578227, 12581337, 12710929, 12826737, 12847166, 14568818, 15036206, 15115761, 15266787, 15293277, 15297935, 15495240, 15615630, 15792962, 15892300, 16000317, 16092076, 16195395, 16239184, 16554120, 16691120, 16839689, 16987883, 17003492, 17085483, 17174556, 17320831, 17357082, 17386961, 17493041, 17555970, 17590238, 18022644, 18093153, 18162161, 18625456, 18785640, 18854867, 18930114, 19001166, 19022385, 19090983, 19458322, 19879020, 19912324, 20413880, 20460118, 20498436, 20704554, 20838030, 20858961, 21568901, 21685912, 22102449, 22221882, 22424094, 22556362, 22723018, 22818528, 22862741, 22911817, 23001634, 23428180, 24252572, 24372973, 24503276, 25402454, 25443551, 25862286, 26077951, 26159191, 26444794, 26861289, 26891767, 26936765, 27115769, 27439681, 27697694, 27797445, 27813160, 27997036, 28271184, 28402959, 28610892, 28653647, 28974731, 29076559, 29206491, 29232559, 29253099, 29254665, 29621183, 29630712, 29636460, 29902389, 29926172, 29948175, 29986742, 30126037, 30193298, 30674342, 30882841, 31059154, 31122495, 31366728, 31631020, 31689387, 31695675, 7572077, 9630238, 9697937, 9708963, 9781517, 9877531, 9932968		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Progressive supranuclear palsy	Progressive Supranuclear Palsy	CTD_human_DG	12325083, 19458322, 21685912, 25402454		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Progressive supranuclear palsy	Progressive Supranuclear Palsy	LHGDN	12629248, 12847166, 15115761, 15266787, 16157753, 16195395, 17274033, 19090983		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Progressive supranuclear palsy	Progressive Supranuclear Palsy	GWASCAT_DG	21685912, 31059154		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Progressive supranuclear palsy	Progressive Supranuclear Palsy	GWASDB_DG	21685912		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Progressive supranuclear palsy	Progressive Supranuclear Palsy	ORPHANET_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Progressive supranuclear palsy atypical	Progressive supranuclear palsy	Pubtator	16495230, 17675576	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Progressive supranuclear palsy-corticobasal syndrome	Supranuclear Palsy-Corticobasal Syndrome	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Progressive supranuclear palsy-parkinsonism syndrome	Supranuclear Palsy-Parkinsonism Syndrome	Orphanet			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Progressive supranuclear palsy-progressive non-fluent aphasia syndrome	Supranuclear Palsy-Progressive Non-Fluent Aphasia Syndrome	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Progressive supranuclear palsy-pure akinesia with gait freezing syndrome	Supranuclear Palsy-Pure Akinesia With Gait Freezing Syndrome	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate carcinoma	Prostate cancer	BEFREE	30823906		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	19681044, 30823906, 32568785, 33811272, 37000265, 37108754	Associate	★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychotic disorders	Pubtator	21093110, 24069608, 24731519	Associate	★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	24103379, 9629852		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Ramsay Hunt Paralysis Syndrome	Ramsay Hunt Paralysis Syndrome	CTD_human_DG	10802785, 19458322		★☆☆☆☆ Found in Text Mining only
Respiratory Failure	Respiratory Failure	CTD_human_DG	14595660		★☆☆☆☆ Found in Text Mining only
Restless Legs Syndrome	Willis-ekbom disease	Pubtator	32767721	Associate	★☆☆☆☆ Found in Text Mining only
Retrocollis	Retrocollis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	28586827		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	21908872		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	20708332, 31504236		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	27287230, 31504236	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scleroderma Systemic	Systemic sclerosis	Pubtator	26792595	Associate	★☆☆☆☆ Found in Text Mining only
Semantic Dementia	Semantic Dementia	CTD_human_DG	10802785, 11117542, 11912108, 16495328, 9641683, 9789048		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Semantic Dementia	Semantic Dementia	BEFREE	11072138, 16222525, 18357425, 20598713, 21555888, 28100023		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Semantic Dementia	Semantic Dementia	ORPHANET_DG	23597030		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Semantic dementia	Semantic Dementia	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Senile Paranoid Dementia	Senile Paranoid Dementia	CTD_human_DG	11889249, 22300406		★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	10318930, 10818513, 12369957, 12410385, 15270198, 16246446, 17017867, 17179995, 18511295, 22291217, 22917148, 23827971, 24712999, 25212914, 25561438, 25927677, 27145445, 27701410, 28238167, 28339396, 28623460, 28652376, 29183770, 29200096, 29274586, 29338678, 29377514, 29441009, 29467648, 29551659, 29844403, 30003951, 30459036, 30696107, 30767082, 30964647, 31274278, 31695992, 31816853, 7525898, 7534068, 7761390, 8513392		★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	HPO_DG			★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	35896530	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	39456840	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Syndromes	Sleep apnea	Pubtator	24439479	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Disorders	Sleep Disorders	BEFREE	28455102, 30353822		★☆☆☆☆ Found in Text Mining only
Sleep Disorders	Sleep Disorders	HPO_DG			★☆☆☆☆ Found in Text Mining only
Spastic Paraplegia Hereditary	Hereditary spastic paraplegia	Pubtator	26506339	Associate	★☆☆☆☆ Found in Text Mining only
Speech Disorders	Speech Disorders	HPO_DG			★☆☆☆☆ Found in Text Mining only
Stereotyped Behavior	Stereotyped Behavior	HPO_DG			★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	23423488, 24722794		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	16721363, 23446558, 38062820	Associate	★☆☆☆☆ Found in Text Mining only
Strudwick syndrome	Strudwick Syndrome	BEFREE	19884571		★☆☆☆☆ Found in Text Mining only
Supranuclear Palsy Progressive	Progressive supranuclear palsy	Pubtator	10037497, 10209184, 11861703, 14707330, 15792962, 16157753, 17357082, 17602795, 18315566, 18854867, 19001166, 19912324, 20838030, 21685912, 21908872, 22009441, 22027014, 22221882, 22424094, 22556362, 22723018, 22862741, 22950410, 23428180, 23432126, 23518664, 24086518, 24252572, 24503276, 24899730, 25402454, 25443551, 26077951, 26220942, 26373282, 26506339, 26923020, 26936765, 27115769, 27697694, 27709663, 27709685, 28019685, 28087578, 28100725, 28268100, 28974731, 29076559, 29082658, 29084565, 29253099, 29293892, 29502334, 29630712, 29986742, 30050033, 30089514, 30136084, 30238240, 30882841, 31059154, 31319800, 31358628, 31433871, 31631020, 31935638, 31953414, 31999351, 32019605, 32759167, 32951237, 33635380, 34298918, 34587152, 34588692, 34689836, 34874463, 34965173, 35135879, 35384155, 35421130, 35422444, 35485527, 35842134, 35976433, 36102964, 36162501, 36215050, 36701008, 37354322, 37431188, 37703311, 37803326, 37894815, 37904205, 38134678, 38310108, 38605589, 38631765, 39251599, 40082954, 40132252, 40254117, 40545554, 40618089	Associate	★☆☆☆☆ Found in Text Mining only
Supranuclear Palsy Progressive	Progressive supranuclear palsy	Pubtator	17675576	Stimulate	★☆☆☆☆ Found in Text Mining only
Supranuclear Palsy, Progressive, 1	Supranuclear Palsy	UNIPROT_DG	10534245, 11220749, 12325083, 14991828, 14991829, 16157753		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Supranuclear Palsy, Progressive, 1	Supranuclear Palsy	CTD_human_DG	12325083, 19458322, 21685912, 25402454		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Supranuclear Palsy, Progressive, 1	Supranuclear Palsy	CLINVAR_DG			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Supranuclear Palsy, Progressive, 1	Supranuclear Palsy	GENOMICS_ENGLAND_DG			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Supranuclear Palsy, Progressive, 1, Atypical	Supranuclear Palsy	BEFREE	17274033		★☆☆☆☆ Found in Text Mining only
Supranuclear Palsy, Progressive, 1, Atypical	Supranuclear Palsy	ORPHANET_DG			★☆☆☆☆ Found in Text Mining only
Supranuclear Palsy, Progressive, 1, Atypical	Supranuclear Palsy	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Supranuclear Palsy, Progressive, 1, Atypical	Supranuclear Palsy	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
Supranuclear Palsy, Progressive, 1, Atypical	Supranuclear Palsy	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Syndactyly type 3	Syndactyly	Pubtator	38631765	Stimulate	★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	10218629, 10320789, 10412802, 10517507, 10595524, 10604746, 10725221, 10797541, 10931371, 10959034, 11089577, 11159174, 11164280, 11207421, 11220749, 11578815, 11738505, 11898551, 11930135, 12151839, 12168561, 12231446, 12368474, 12581337, 12649279, 12787326, 12796837, 12853572, 12975285, 14503643, 14528051, 14624025, 14993907, 15033802, 15044677, 15056452, 15064135, 15115761, 15122701, 15140937, 15198676, 15249677, 15270197, 15297935, 15517432, 15615632, 15615637, 15615641, 15615650, 15615814, 15665401, 15750210, 15792962, 15814784, 15888485, 15918074, 15930395, 16182262, 16239184, 16242644, 16371011, 16477009, 16493238, 16507903, 16600994, 16877359, 16930434, 16958643, 16987883, 17050703, 17071927, 17085483, 17127334, 17192721, 17386961, 17409229, 17416103, 17493040, 17517623, 17590238, 17596718, 17604998, 17716969, 17898350, 17932487, 18162161, 18199773, 18346207, 18380664, 18424220, 18448228, 18490011, 18540881, 18785640, 18953105, 18992725, 19074615, 19090983, 19091059, 19118186, 19238406, 19304664, 19355848, 19364361, 19459590, 19542619, 19942317, 19967412, 20004218, 20178834, 20193038, 20413892, 20434528, 20544828, 20658992, 20663882, 20704554, 20920788, 21320871, 21492964, 21550980, 21555888, 21698260, 21705366, 21720721, 21723381, 21739165, 21763469, 21787314, 21794954, 21841002, 21876254, 22022446, 22039833, 22054871, 22102449, 22169201, 22280354, 22433908, 22561128, 22595371, 22611162, 22723018, 22802095, 22817717, 22847631, 22960250, 22975846, 22989354, 22995835, 23105105, 23108673, 23379588, 23395797, 23587140, 23948901, 23999428, 24050961, 24086739, 24252707, 24278307, 24335532, 24479894, 24503275, 24556215, 24614899, 24623856, 24754737, 24788298, 24861427, 24880087, 24887264, 24923570, 24936422, 25153994, 25205109, 25284680, 25408212, 25437199, 25524708, 25687501, 25772164, 25794683, 25804954, 25862286, 25863528, 26362250, 26363795, 26373282, 26374846, 26382841, 26550830, 26576216, 26824039, 26923397, 26936765, 26969684, 27222125, 27479154, 27615390, 27662303, 27663563, 27723722, 27859539, 27878758, 27890528, 27975248, 27975258, 27975259, 28019685, 28059795, 28073379, 28077166, 28215745, 28233851, 28269786, 28271184, 28303942, 28367114, 28413156, 28453489, 28455089, 28456717, 28482642, 28521765, 28523532, 28527208, 28529046, 28536263, 28540657, 28544198, 28587664, 28600952, 28610892, 28760828, 28772101, 28789904, 28827321, 28848737, 28851546, 28859549, 28882308, 28882312, 28914736, 28921979, 28974731, 28983098, 28986461, 29062069, 29089864, 29105391, 29106033, 29121589, 29128902, 29187256, 29203673, 29238289, 29253099, 29259137, 29299792, 29439247, 29493301, 29495325, 29565824, 29584657, 29630551, 29644863, 29729314, 29730992, 29770957, 29772786, 29793417, 29794074, 29886529, 29886530, 29886548, 29886549, 29894752, 29936232, 29991349, 30014313, 30036493, 30068389, 30096486, 30124450, 30137327, 30149687, 30168573, 30189205, 30193298, 30242125, 30261006, 30290707, 30321409, 30348585, 30355322, 30386294, 30386817, 30388894, 30394813, 30423399, 30442948, 30463001, 30479844, 30497516, 30529601, 30531722, 30535461, 30546007, 30550860, 30562452, 30619849, 30665005, 30674342, 30708351, 30742061, 30744518, 30769286, 30907729, 30917861, 30925618, 30980950, 31013607, 31027853, 31046227, 31141609, 31152932, 31156179, 31172290, 31175300, 31203391, 31223056, 31238088, 31239479, 31306814, 31317824, 31391090, 31470053, 31522011, 31572186, 31661961, 31667556, 31685653, 31689387, 31702011, 31780921, 31824299, 31826239		★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	CTD_human_DG	10604746, 11889249, 14595660, 24556215, 27569447		★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	LHGDN	12112079, 12872001, 15053964, 15950767, 16246844, 16477009, 16609851, 16958643, 18065436, 18490011		★☆☆☆☆ Found in Text Mining only
Telomeric 22q13 Monosomy Syndrome	22q13 monosomy syndrome	Pubtator	37670319	Associate	★☆☆☆☆ Found in Text Mining only
Temporal cortical atrophy	Temporal cortical atrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Tonic - clonic seizures	Seizure	HPO_DG			★☆☆☆☆ Found in Text Mining only
Torsades de Pointes	Torsades de pointes	Pubtator	29514947, 29554190, 29926172	Associate	★☆☆☆☆ Found in Text Mining only
Tremor	Tremor	Pubtator	20561037, 37746582	Associate	★☆☆☆☆ Found in Text Mining only
Tremor	Tremor	Pubtator	28332604	Stimulate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neurogenic	Neurogenic bladder	Pubtator	33804213	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	31374883		★☆☆☆☆ Found in Text Mining only
Ventricular Fibrillation	Ventricular fibrillation	Pubtator	27080260, 32291284	Associate	★☆☆☆☆ Found in Text Mining only
Vertical supranuclear gaze palsy	Supranuclear gaze palsy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Vision Disorders	Visual disorder	Pubtator	32762790	Associate	★☆☆☆☆ Found in Text Mining only
Wernicke Encephalopathy	Wernicke Encephalopathy	LHGDN	18445112		★☆☆☆☆ Found in Text Mining only