MAOB (monoamine oxidase B)

Gene

• Entrez ID: 4129
• Gene name: Monoamine oxidase B
• Gene symbol: MAOB
• Synonyms (NCBI Gene): -
• Chromosome: X
• Chromosome location: Xp11.3
• Summary: The protein encoded by this gene belongs to the flavin monoamine oxidase family. It is a enzyme located in the mitochondrial outer membrane. It catalyzes the oxidative deamination of biogenic and xenobiotic amines and plays an important role in the metabo

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT536189	hsa-miR-335-5p	PAR-CLIP	22012620
MIRT536188	hsa-miR-4426	PAR-CLIP	22012620
MIRT536187	hsa-miR-4647	PAR-CLIP	22012620
MIRT536186	hsa-miR-4662b	PAR-CLIP	22012620
MIRT536185	hsa-miR-4786-3p	PAR-CLIP	22012620
MIRT536184	hsa-miR-671-5p	PAR-CLIP	22012620
MIRT536183	hsa-miR-628-5p	PAR-CLIP	22012620
MIRT536189	hsa-miR-335-5p	PAR-CLIP	22012620
MIRT536188	hsa-miR-4426	PAR-CLIP	22012620
MIRT536187	hsa-miR-4647	PAR-CLIP	22012620
MIRT536186	hsa-miR-4662b	PAR-CLIP	22012620
MIRT536185	hsa-miR-4786-3p	PAR-CLIP	22012620
MIRT536184	hsa-miR-671-5p	PAR-CLIP	22012620
MIRT536183	hsa-miR-628-5p	PAR-CLIP	22012620
MIRT1127646	hsa-miR-1185	CLIP-seq
MIRT1127647	hsa-miR-1252	CLIP-seq
MIRT1127648	hsa-miR-2114	CLIP-seq
MIRT1127649	hsa-miR-3173-3p	CLIP-seq
MIRT1127650	hsa-miR-3679-5p	CLIP-seq
MIRT1127651	hsa-miR-4270	CLIP-seq
MIRT1127652	hsa-miR-4441	CLIP-seq
MIRT1127653	hsa-miR-4474-3p	CLIP-seq
MIRT1127654	hsa-miR-599	CLIP-seq
MIRT1127655	hsa-miR-760	CLIP-seq
MIRT2266488	hsa-miR-3650	CLIP-seq
MIRT2438474	hsa-miR-490-5p	CLIP-seq
MIRT2438475	hsa-miR-511	CLIP-seq
MIRT2453644	hsa-miR-3125	CLIP-seq
MIRT2453645	hsa-miR-3613-3p	CLIP-seq
MIRT2453646	hsa-miR-3916	CLIP-seq
MIRT2453647	hsa-miR-4668-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CDCA7L	Repression	20980443
EAPP	Repression	20980443
RARA	Unknown	19401466
SP1	Unknown	11259630;20980443
SP3	Unknown	11259630
SP4	Activation	11259630

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	28514442, 30021884, 32296183, 32814053, 33961781
GO:0005739	Component	Mitochondrion	HDA	20833797
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	ISS
GO:0005740	Component	Mitochondrial envelope	TAS	7063850
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0005741	Component	Mitochondrial outer membrane	TAS	24252804
GO:0008131	Function	Primary methylamine oxidase activity	IBA
GO:0008131	Function	Primary methylamine oxidase activity	IDA	20493079
GO:0008131	Function	Primary methylamine oxidase activity	IEA
GO:0008131	Function	Primary methylamine oxidase activity	ISS
GO:0009055	Function	Electron transfer activity	TAS	8602220
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0021762	Process	Substantia nigra development	HEP	22926577
GO:0042420	Process	Dopamine catabolic process	IEA
GO:0042420	Process	Dopamine catabolic process	TAS	24252804
GO:0050660	Function	Flavin adenine dinucleotide binding	IBA
GO:0050665	Process	Hydrogen peroxide biosynthetic process	NAS	24252804
GO:0097621	Function	Monoamine oxidase activity	IDA	20493079
GO:0097621	Function	Monoamine oxidase activity	IEA

Other IDs

• MIM: 309860
• HGNC: 6834
• e!Ensembl: ENSG00000069535

Protein

• UniProt ID: P27338
• Protein name: Amine oxidase [flavin-containing] B (EC 1.4.3.21) (EC 1.4.3.4) (Monoamine oxidase type B) (MAO-B)
• Protein function: Catalyzes the oxidative deamination of primary and some secondary amines such as neurotransmitters, and exogenous amines including the tertiary amine, neurotoxin 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (MPTP), with concomitant reduction of
• PDB: 1GOS, 1OJ9, 1OJA, 1OJC, 1OJD, 1S2Q, 1S2Y, 1S3B, 1S3E, 2BK3, 2BK4, 2BK5, 2BYB, 2C64, 2C65, 2C66, 2C67, 2C70, 2C72, 2C73, 2C75, 2C76, 2V5Z, 2V60, 2V61, 2VRL, 2VRM, 2VZ2, 2XCG, 2XFN, 2XFO, 2XFP, 2XFQ, 2XFU, 3PO7, 3ZYX, 4A79, 4A7A, 4CRT, 5MRL, 6FVZ, 6FW0, 6FWC, 6RKB, 6RKP, 6RLE, 6YT2, 7B0V, 7B0Z, 7P4F, 7P4H
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01593	Amino_oxidase	14 → 451	Flavin containing amine oxidoreductase	Domain

• Sequence:

  MSNKCDVVVVGGGISGMAAAKLLHDSGLNVVVLEARDRVGGRTYTLRNQKVKYVDLGGSY
  VGPTQNRILRLAKELGLETYKVNEVERLIHHVKGKSYPFRGPFPPVWNPITYLDHNNFWR
  TMDDMGREIPSDAPWKAPLAEEWDNMTMKELLDKLCWTESAKQLATLFVNLCVTAETHEV
  SALWFLWYVKQCGGTTRIISTTNGGQERKFVGGSGQVSERIMDLLGDRVKLERPVIYIDQ
  TRENVLVETLNHEMYEAKYVISAIPPTLGMKIHFNPPLPMMRNQMITRVPLGSVIKCIVY
  YKEPFWRKKDYCGTMIIDGEEAPVAYTLDDTKPEGNYAAIMGFILAHKARKLARLTKEER
  LKKLCELYAKVLGSLEALEPVHYEEKNWCEEQYSGGCYTTYFPPGILTQYGRVLRQPVDR
  IYFAGTETATHWSGYMEGAVEAGERAAREILHAMGKIPEDEIWQSEPESVDVPAQPITTT
  FLERHLPSVPGLLRLIGLTTIFSATALGFLAHKRGLLVRV

• Sequence length: 520

Pathways

KEGG:

Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Serotonergic synapse
Dopaminergic synapse
Parkinson disease
Cocaine addiction
Amphetamine addiction
Alcoholism

Reactome:

Biogenic amines are oxidatively deaminated to aldehydes by MAOA and MAOB

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMERS DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANEMIA, MEGALOBLASTIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATIC ENCEPHALOPATHY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HUNTINGTON DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTENSION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTERNET ADDICTION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PHEOCHROMOCYTOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Abnormal involuntary movement	Abnormal Involuntary Movement	BEFREE	15261699		★☆☆☆☆ Found in Text Mining only
Acute Confusional Senile Dementia	Senile Dementia	CTD_human_DG	21075085, 7816197		★☆☆☆☆ Found in Text Mining only
Akinetic-Rigid Variant of Huntington Disease	Akinetic-Rigid Variant Of Huntington Disease	CTD_human_DG	21075085		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	31771069, 36006974, 36776057	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Early Onset	Alzheimer disease	CTD_human_DG	21075085, 7816197		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	CTD_human_DG	21075085, 7816197		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	CTD_human_DG	21075085, 7816197		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease, Focal Onset	Alzheimer disease	CTD_human_DG	21075085, 7816197		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	10619718, 30192007		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	31591353		★☆☆☆☆ Found in Text Mining only
Anemia, Megaloblastic	Anemia	CTD_human_DG	7430361		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Antisocial Personality Disorder	Antisocial Personality Disorder	BEFREE	17592478, 26851573		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	28251298		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	28251298		★☆☆☆☆ Found in Text Mining only
Aphasia	Aphasia	Pubtator	22365943	Inhibit	★☆☆☆☆ Found in Text Mining only
Aphasia	Aphasia	Pubtator	34287249	Associate	★☆☆☆☆ Found in Text Mining only
Aromatic amino acid decarboxylase deficiency	Aromatic amino acid decarboxylase deficiency	BEFREE	27371992		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	37238670	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	26689994	Associate	★☆☆☆☆ Found in Text Mining only
Attention Deficit and Disruptive Behavior Disorders	Attention deficit hyperactivity disorder	Pubtator	18430257	Associate	★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	18430257, 27341797, 28982350	Associate	★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	10374746, 10898902, 11803531, 15717295, 16959425, 17918234, 17938636, 18430257, 21610556, 27341797, 28982350		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	20479760	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	20479760, 27381555, 31275445		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	CTD_human_DG	19221690		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	Pubtator	24453887, 31275445	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	BEFREE	28151561		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	BEFREE	10686545		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	10686545, 7485270, 9342194		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Borderline Personality Disorder	Borderline personality disorder	BEFREE	22139575, 30242487		★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	Pubtator	22139575	Associate	★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	23915421	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	29261141, 29775160	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32094232	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	30076780	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	27914011, 29283314		★☆☆☆☆ Found in Text Mining only
Classical Lissencephalies and Subcortical Band Heterotopias	Lissencephaly	Pubtator	39395470	Associate	★☆☆☆☆ Found in Text Mining only
Classical phenylketonuria	Phenylketonuria	BEFREE	15589121		★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	30016860		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	30906861		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	CTD_human_DG	15059925		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32316576, 35395711	Associate	★☆☆☆☆ Found in Text Mining only
Conduct Disorder	Conduct Disorder	BEFREE	26851573		★☆☆☆☆ Found in Text Mining only
Contiguous gene syndrome	Contiguous gene syndrome	BEFREE	1308352		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30076780		★☆☆☆☆ Found in Text Mining only
Cytochrome c Oxidase Deficiency	Cytochrome c oxidase deficiency	Pubtator	8503438	Associate	★☆☆☆☆ Found in Text Mining only
Deficiency of aromatic-L-amino-acid decarboxylase	Deficiency Of Aromatic-L-Amino-Acid Decarboxylase	BEFREE	27371992		★☆☆☆☆ Found in Text Mining only
Delirium	Delirium	Pubtator	38227609	Associate	★☆☆☆☆ Found in Text Mining only
Delusions	Delusions	BEFREE	22414661		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	PSYGENET_DG	19268543, 19657584, 22414661		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	19268543	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	BEFREE	19657584, 29496172, 29552556, 30964563, 30964996		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder Major	Major depressive disorder	Pubtator	19657584	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	11800140	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	11800140		★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	20485326	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	38336992	Associate	★☆☆☆☆ Found in Text Mining only
Dyskinetic syndrome	Dyskinetic Syndrome	BEFREE	25034874, 28550482, 29441484, 29526790, 30986504		★☆☆☆☆ Found in Text Mining only
EAR, PATELLA, SHORT STATURE SYNDROME	Ear Diseases	BEFREE	19506579		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	11800140		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	31271496		★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	CTD_human_DG	21063030		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	CTD_human_DG	21063030		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Essential Hypertension	Hypertension	Pubtator	31743621	Associate	★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	CTD_human_DG	21075085, 7816197		★☆☆☆☆ Found in Text Mining only
Fulminant Hepatic Failure with Cerebral Edema	Fulminant Hepatic Failure With Cerebral Edema	CTD_human_DG	10564534		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	20022592, 29279995, 29844863, 30985435, 31130597		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	26689994, 35802478	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	20022592, 29279995, 29844863, 30985435, 31130597		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	26689994	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	29140741, 29844863, 30259128		★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	20485326		★☆☆☆☆ Found in Text Mining only
Hallucinations	Hallucinations	BEFREE	22414661		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	31743621		★☆☆☆☆ Found in Text Mining only
Hepatic Coma	Hepatic Coma	CTD_human_DG	10564534		★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Hepatic Encephalopathy	CTD_human_DG	10564534		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatic Encephalopathy	Hepatic Encephalopathy	BEFREE	9048767		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatic Stupor	Hepatic Stupor	CTD_human_DG	10564534		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	CTD_human_DG	21075085		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Huntington Disease, Late Onset	Huntington Disease	CTD_human_DG	21075085		★☆☆☆☆ Found in Text Mining only
Hyperprolactinemia	Hyperprolactinemia	BEFREE	30967134		★☆☆☆☆ Found in Text Mining only
Hyperprolactinemia	Hyperproinsulinemia	Pubtator	30967134	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	31743621	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	30738894, 31743621		★☆☆☆☆ Found in Text Mining only
Hypogonadism	Hypogonadism	Pubtator	31743621	Associate	★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	29521253, 30110536, 30906861		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	22365943	Associate	★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	8613523		★☆☆☆☆ Found in Text Mining only
Juvenile Huntington Disease	Huntington Disease	CTD_human_DG	21075085		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	30076780		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	18751929		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	15936531		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	15936531		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	17640790, 19657584, 28515684, 29561824, 30840042		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	17640790, 19657584		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29336068, 30076780		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	CTD_human_DG	15059925		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	29050386, 8541872		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	PSYGENET_DG	19268543, 19657584, 22414661		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	BEFREE	19657584, 29496172, 29552556, 30964563, 30964996		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	21978760, 30242487, 8154672		★☆☆☆☆ Found in Text Mining only
Mental impairment	Mental Depression	BEFREE	22365943		★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	8613523		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	15694196		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	21678067	Associate	★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	10686545, 9342198		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	PSYGENET_DG	10686545, 9342194, 9342198		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	30154729		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	22569243		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	15247489, 28273563, 28283959, 28642233, 28685208		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	20022592, 29279995		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	15024015, 19526291, 33284012, 35196956, 38227609	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	10619718, 23326597, 25604428, 27863747, 28084742, 28642233, 29126727, 29138643, 29247860, 29279995, 29324067, 29335210, 29400049, 29496172, 30279044, 30604512, 30727777, 30789704, 30813423, 31115748, 31291696, 31537422, 31826305		★☆☆☆☆ Found in Text Mining only
Night blindness congenital stationary	Night blindness, congenital stationary	Pubtator	7966198	Associate	★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	26906215, 30259128		★☆☆☆☆ Found in Text Mining only
Norrie disease	Norrie Disease	BEFREE	1301161, 1308352, 20679667, 2293615, 2773935, 7759098, 7814029, 8401512, 8541872, 8613523, 9326944		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	16674552		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	31743621	Associate	★☆☆☆☆ Found in Text Mining only
Oppositional Defiant Disorder	Oppositional Defiant Disorder	BEFREE	18430257		★☆☆☆☆ Found in Text Mining only
Paranoid Schizophrenia	Paranoid Schizophrenia	BEFREE	8804132		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	10091612, 10619718, 10701898, 10990520, 11085911, 12428723, 12465073, 12815660, 12815741, 14732367, 14743364, 15247489, 15355491, 15699372, 17044053, 17270484, 17447416, 17868389, 18205889, 18327668, 21781348, 22093536, 22974659, 23093014, 23319194, 23326597, 23810676, 25034874, 26000819, 27190009, 27421021, 27855360, 27863747, 27911341, 28067172, 28069007, 28093210, 28093976, 28124620, 28144826, 28294055, 28332824, 28515684, 28550482, 28685208, 29050386, 29126727, 29127552, 29138643, 29159774, 29198609, 29335210, 29339253, 29417334, 29477889, 29552556, 29561824, 29569037, 29578580, 29648817, 29713806, 29769405, 29847694, 29934198, 29956417, 30004136, 30017881, 30077198, 30129404, 30205936, 30214392, 30216543, 30279044, 30359642, 30386930, 30534374, 30599413, 30618632, 30635744, 30666491, 30689042, 30731360, 30813423, 30833108, 30877626, 30963543, 30964996, 31005056, 31017021, 31115748, 31146671, 31268358, 31336891, 31421966, 31426448, 31427934, 31537422, 31562557, 31639490, 31836905, 7695241, 7913737, 8489207, 8825899, 8929994, 9129714, 9596006, 9642149		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	10990520, 20624440, 21781348, 22974659, 23093014, 23319194, 29578580, 32786232, 33539026, 36006974, 38227609	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	LHGDN	12428723, 17270484, 18205889		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	CTD_human_DG	21318773		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease Secondary	Secondary parkinson disease	Pubtator	2023912	Associate	★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	11171904, 27911341, 30534374		★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	10701898, 17447416, 29050386, 29292157, 29309800, 30017881, 31572166		★☆☆☆☆ Found in Text Mining only
Phenylketonurias	Phenylketonuria	BEFREE	15589121		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	CTD_human_DG	22569243		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pheochromocytoma, Extra-Adrenal	Extra-Adrenal Pheochromocytoma	CTD_human_DG	22569243		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	CTD_human_DG	21075085, 7816197		★☆☆☆☆ Found in Text Mining only
Progressive supranuclear palsy	Progressive Supranuclear Palsy	BEFREE	29050386, 29387005, 29958546, 31795034		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychotic disorders	Pubtator	19268543	Associate	★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	25073638		★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	31743621	Associate	★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30076780		★☆☆☆☆ Found in Text Mining only
Restless Legs Syndrome	Restless Legs Syndrome	BEFREE	12136060, 20589923		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	10697823, 14643089, 15211623, 15261699, 18832861, 19268543, 19508883, 20479760, 20589923, 21978760, 22414661, 25073638, 26851573, 28094812, 30967134, 8804132, 9034005, 9211575		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	CTD_human_DG	20479760		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	20479760, 34287249	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seizures	Seizures	Pubtator	22365943	Associate	★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	CTD_human_DG	7816197		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	33855088	Associate	★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	29221756		★☆☆☆☆ Found in Text Mining only
Thiamine Deficiency	Thiamine Deficiency	BEFREE	28342849		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	19268543, 34287249	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	29261141		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	29261141	Stimulate	★☆☆☆☆ Found in Text Mining only
Turner Syndrome	Turner Syndrome	BEFREE	16412409		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	17640790, 19657584, 28515684, 30840042		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	PSYGENET_DG	17640790, 19657584		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	34819038, 36233054	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	23670301		★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	22572099		★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	22572099		★☆☆☆☆ Found in Text Mining only
Young onset Parkinson disease	Parkinson disease	BEFREE	17270484		★☆☆☆☆ Found in Text Mining only