SMAD7 (SMAD family member 7)

Gene

• Entrez ID: 4092
• Gene name: SMAD family member 7
• Gene symbol: SMAD7
• Synonyms (NCBI Gene): CRCS3, MADH7, MADH8
• Chromosome: 18
• Chromosome location: 18q21.1
• Summary: The protein encoded by this gene is a nuclear protein that binds the E3 ubiquitin ligase SMURF2. Upon binding, this complex translocates to the cytoplasm, where it interacts with TGF-beta receptor type-1 (TGFBR1), leading to the degradation of both the en

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs4939827	T>A,C	Risk-factor	Intron variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT007153	hsa-miR-217	Luciferase reporter assay	23471579
MIRT007153	hsa-miR-217	Luciferase reporter assay	23471579
MIRT007154	hsa-miR-216a-5p	Luciferase reporter assay	23471579
MIRT007242	hsa-miR-25-3p	Luciferase reporter assay	23435373
MIRT007362	hsa-miR-21-5p	qRT-PCR, Western blot	23292313
MIRT007362	hsa-miR-21-5p	qRT-PCR, Western blot	23292313
MIRT027015	hsa-miR-103a-3p	Sequencing	20371350
MIRT027482	hsa-miR-98-5p	Microarray	19088304
MIRT028980	hsa-miR-26b-5p	Microarray	19088304
MIRT031521	hsa-miR-16-5p	Sequencing	20371350
MIRT049511	hsa-miR-92a-3p	CLASH	23622248
MIRT048391	hsa-miR-100-5p	CLASH	23622248
MIRT046499	hsa-miR-15b-5p	CLASH	23622248
MIRT053159	hsa-miR-20a-5p	Luciferase reporter assay, qRT-PCR, Western blot	23665284
MIRT053873	hsa-miR-106b-5p	Luciferase reporter assay, qRT-PCR, Western blot	22286770
MIRT053874	hsa-miR-93-5p	Luciferase reporter assay, qRT-PCR, Western blot	22286770
MIRT007242	hsa-miR-25-3p	Luciferase reporter assay, qRT-PCR, Western blot	22286770
MIRT053873	hsa-miR-106b-5p	Flow, Immunofluorescence, Microarray, qRT-PCR, Western blot	25286029
MIRT007362	hsa-miR-21-5p	Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, Western blot	24887517
MIRT046499	hsa-miR-15b-5p	Luciferase reporter assay, qRT-PCR, Western blot	24435757
MIRT437832	hsa-miR-520g-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	25436421
MIRT437832	hsa-miR-520g-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	25436421
MIRT501089	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT501088	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT031521	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT501087	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT046499	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT501086	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT501085	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT501084	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT501083	hsa-miR-595	PAR-CLIP	20371350
MIRT501082	hsa-miR-510-5p	PAR-CLIP	20371350
MIRT501081	hsa-miR-646	PAR-CLIP	20371350
MIRT501080	hsa-miR-1244	PAR-CLIP	20371350
MIRT501079	hsa-miR-3973	PAR-CLIP	20371350
MIRT501078	hsa-miR-545-3p	PAR-CLIP	20371350
MIRT501077	hsa-miR-4768-3p	PAR-CLIP	20371350
MIRT501076	hsa-miR-4459	PAR-CLIP	20371350
MIRT501075	hsa-miR-4433a-3p	PAR-CLIP	20371350
MIRT501074	hsa-miR-3664-3p	PAR-CLIP	20371350
MIRT501073	hsa-miR-4795-5p	PAR-CLIP	20371350
MIRT501072	hsa-miR-766-5p	PAR-CLIP	20371350
MIRT501071	hsa-miR-6735-3p	PAR-CLIP	20371350
MIRT501070	hsa-miR-663b	PAR-CLIP	20371350
MIRT501069	hsa-miR-644a	PAR-CLIP	20371350
MIRT501068	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT501067	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT501066	hsa-miR-3616-5p	PAR-CLIP	20371350
MIRT501065	hsa-miR-573	PAR-CLIP	20371350
MIRT501064	hsa-miR-7108-5p	PAR-CLIP	20371350
MIRT501063	hsa-miR-374b-3p	PAR-CLIP	20371350
MIRT501089	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT501088	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT031521	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT501087	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT046499	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT501086	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT501085	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT501084	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT501083	hsa-miR-595	PAR-CLIP	20371350
MIRT501082	hsa-miR-510-5p	PAR-CLIP	20371350
MIRT501081	hsa-miR-646	PAR-CLIP	20371350
MIRT501080	hsa-miR-1244	PAR-CLIP	20371350
MIRT501079	hsa-miR-3973	PAR-CLIP	20371350
MIRT501078	hsa-miR-545-3p	PAR-CLIP	20371350
MIRT501077	hsa-miR-4768-3p	PAR-CLIP	20371350
MIRT501076	hsa-miR-4459	PAR-CLIP	20371350
MIRT501075	hsa-miR-4433a-3p	PAR-CLIP	20371350
MIRT501074	hsa-miR-3664-3p	PAR-CLIP	20371350
MIRT501073	hsa-miR-4795-5p	PAR-CLIP	20371350
MIRT501072	hsa-miR-766-5p	PAR-CLIP	20371350
MIRT501071	hsa-miR-6735-3p	PAR-CLIP	20371350
MIRT501070	hsa-miR-663b	PAR-CLIP	20371350
MIRT501069	hsa-miR-644a	PAR-CLIP	20371350
MIRT501068	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT501067	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT501066	hsa-miR-3616-5p	PAR-CLIP	20371350
MIRT501065	hsa-miR-573	PAR-CLIP	20371350
MIRT501064	hsa-miR-7108-5p	PAR-CLIP	20371350
MIRT501063	hsa-miR-374b-3p	PAR-CLIP	20371350
MIRT501089	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT501088	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT031521	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT501087	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT046499	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT501086	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT501085	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT501084	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT501083	hsa-miR-595	PAR-CLIP	20371350
MIRT501082	hsa-miR-510-5p	PAR-CLIP	20371350
MIRT501081	hsa-miR-646	PAR-CLIP	20371350
MIRT501080	hsa-miR-1244	PAR-CLIP	20371350
MIRT501079	hsa-miR-3973	PAR-CLIP	20371350
MIRT501078	hsa-miR-545-3p	PAR-CLIP	20371350
MIRT501077	hsa-miR-4768-3p	PAR-CLIP	20371350
MIRT501076	hsa-miR-4459	PAR-CLIP	20371350
MIRT501075	hsa-miR-4433a-3p	PAR-CLIP	20371350
MIRT501074	hsa-miR-3664-3p	PAR-CLIP	20371350
MIRT501073	hsa-miR-4795-5p	PAR-CLIP	20371350
MIRT501072	hsa-miR-766-5p	PAR-CLIP	20371350
MIRT501071	hsa-miR-6735-3p	PAR-CLIP	20371350
MIRT501070	hsa-miR-663b	PAR-CLIP	20371350
MIRT501069	hsa-miR-644a	PAR-CLIP	20371350
MIRT501068	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT501067	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT501066	hsa-miR-3616-5p	PAR-CLIP	20371350
MIRT501065	hsa-miR-573	PAR-CLIP	20371350
MIRT501064	hsa-miR-7108-5p	PAR-CLIP	20371350
MIRT501063	hsa-miR-374b-3p	PAR-CLIP	20371350
MIRT501089	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT501088	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT031521	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT501087	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT046499	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT501086	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT501085	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT501084	hsa-miR-503-5p	PAR-CLIP	21572407
MIRT501083	hsa-miR-595	PAR-CLIP	21572407
MIRT501082	hsa-miR-510-5p	PAR-CLIP	21572407
MIRT501081	hsa-miR-646	PAR-CLIP	21572407
MIRT501080	hsa-miR-1244	PAR-CLIP	21572407
MIRT501079	hsa-miR-3973	PAR-CLIP	21572407
MIRT501078	hsa-miR-545-3p	PAR-CLIP	21572407
MIRT501077	hsa-miR-4768-3p	PAR-CLIP	21572407
MIRT501076	hsa-miR-4459	PAR-CLIP	21572407
MIRT501075	hsa-miR-4433a-3p	PAR-CLIP	21572407
MIRT501074	hsa-miR-3664-3p	PAR-CLIP	21572407
MIRT501073	hsa-miR-4795-5p	PAR-CLIP	21572407
MIRT501072	hsa-miR-766-5p	PAR-CLIP	21572407
MIRT501071	hsa-miR-6735-3p	PAR-CLIP	21572407
MIRT501070	hsa-miR-663b	PAR-CLIP	21572407
MIRT501069	hsa-miR-644a	PAR-CLIP	21572407
MIRT501068	hsa-miR-4524a-5p	PAR-CLIP	21572407
MIRT501067	hsa-miR-4524b-5p	PAR-CLIP	21572407
MIRT501066	hsa-miR-3616-5p	PAR-CLIP	21572407
MIRT501065	hsa-miR-573	PAR-CLIP	21572407
MIRT501064	hsa-miR-7108-5p	PAR-CLIP	21572407
MIRT501063	hsa-miR-374b-3p	PAR-CLIP	21572407
MIRT501089	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT501088	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT031521	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT501087	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT046499	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT501086	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT501085	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT501084	hsa-miR-503-5p	PAR-CLIP	23446348
MIRT501083	hsa-miR-595	PAR-CLIP	23446348
MIRT501082	hsa-miR-510-5p	PAR-CLIP	23446348
MIRT501081	hsa-miR-646	PAR-CLIP	23446348
MIRT501080	hsa-miR-1244	PAR-CLIP	23446348
MIRT501079	hsa-miR-3973	PAR-CLIP	23446348
MIRT501078	hsa-miR-545-3p	PAR-CLIP	23446348
MIRT501077	hsa-miR-4768-3p	PAR-CLIP	23446348
MIRT501076	hsa-miR-4459	PAR-CLIP	23446348
MIRT501075	hsa-miR-4433a-3p	PAR-CLIP	23446348
MIRT501073	hsa-miR-4795-5p	PAR-CLIP	23446348
MIRT501072	hsa-miR-766-5p	PAR-CLIP	23446348
MIRT501071	hsa-miR-6735-3p	PAR-CLIP	23446348
MIRT501070	hsa-miR-663b	PAR-CLIP	23446348
MIRT501069	hsa-miR-644a	PAR-CLIP	23446348
MIRT501068	hsa-miR-4524a-5p	PAR-CLIP	23446348
MIRT501067	hsa-miR-4524b-5p	PAR-CLIP	23446348
MIRT501066	hsa-miR-3616-5p	PAR-CLIP	23446348
MIRT501065	hsa-miR-573	PAR-CLIP	23446348
MIRT501064	hsa-miR-7108-5p	PAR-CLIP	23446348
MIRT501063	hsa-miR-374b-3p	PAR-CLIP	23446348
MIRT501089	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT501088	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT031521	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT501087	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT046499	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT501086	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT501085	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT501084	hsa-miR-503-5p	PAR-CLIP	23446348
MIRT501083	hsa-miR-595	PAR-CLIP	23446348
MIRT501081	hsa-miR-646	PAR-CLIP	23446348
MIRT501080	hsa-miR-1244	PAR-CLIP	23446348
MIRT501079	hsa-miR-3973	PAR-CLIP	23446348
MIRT501078	hsa-miR-545-3p	PAR-CLIP	23446348
MIRT501077	hsa-miR-4768-3p	PAR-CLIP	23446348
MIRT501076	hsa-miR-4459	PAR-CLIP	23446348
MIRT501075	hsa-miR-4433a-3p	PAR-CLIP	23446348
MIRT501074	hsa-miR-3664-3p	PAR-CLIP	23446348
MIRT501073	hsa-miR-4795-5p	PAR-CLIP	23446348
MIRT501072	hsa-miR-766-5p	PAR-CLIP	23446348
MIRT501071	hsa-miR-6735-3p	PAR-CLIP	23446348
MIRT501070	hsa-miR-663b	PAR-CLIP	23446348
MIRT501069	hsa-miR-644a	PAR-CLIP	23446348
MIRT501068	hsa-miR-4524a-5p	PAR-CLIP	23446348
MIRT501067	hsa-miR-4524b-5p	PAR-CLIP	23446348
MIRT501066	hsa-miR-3616-5p	PAR-CLIP	23446348
MIRT501065	hsa-miR-573	PAR-CLIP	23446348
MIRT501064	hsa-miR-7108-5p	PAR-CLIP	23446348
MIRT501063	hsa-miR-374b-3p	PAR-CLIP	23446348
MIRT501089	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT501088	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT031521	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT501087	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT046499	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT501086	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT501085	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT501084	hsa-miR-503-5p	PAR-CLIP	23446348
MIRT501083	hsa-miR-595	PAR-CLIP	23446348
MIRT501082	hsa-miR-510-5p	PAR-CLIP	23446348
MIRT501081	hsa-miR-646	PAR-CLIP	23446348
MIRT501080	hsa-miR-1244	PAR-CLIP	23446348
MIRT501079	hsa-miR-3973	PAR-CLIP	23446348
MIRT501078	hsa-miR-545-3p	PAR-CLIP	23446348
MIRT501077	hsa-miR-4768-3p	PAR-CLIP	23446348
MIRT501076	hsa-miR-4459	PAR-CLIP	23446348
MIRT501075	hsa-miR-4433a-3p	PAR-CLIP	23446348
MIRT501074	hsa-miR-3664-3p	PAR-CLIP	23446348
MIRT501073	hsa-miR-4795-5p	PAR-CLIP	23446348
MIRT501072	hsa-miR-766-5p	PAR-CLIP	23446348
MIRT501071	hsa-miR-6735-3p	PAR-CLIP	23446348
MIRT501070	hsa-miR-663b	PAR-CLIP	23446348
MIRT501069	hsa-miR-644a	PAR-CLIP	23446348
MIRT501068	hsa-miR-4524a-5p	PAR-CLIP	23446348
MIRT501067	hsa-miR-4524b-5p	PAR-CLIP	23446348
MIRT501066	hsa-miR-3616-5p	PAR-CLIP	23446348
MIRT501065	hsa-miR-573	PAR-CLIP	23446348
MIRT501064	hsa-miR-7108-5p	PAR-CLIP	23446348
MIRT501063	hsa-miR-374b-3p	PAR-CLIP	23446348
MIRT501089	hsa-miR-15a-5p	PAR-CLIP	24398324
MIRT501088	hsa-miR-424-5p	PAR-CLIP	24398324
MIRT031521	hsa-miR-16-5p	PAR-CLIP	24398324
MIRT501087	hsa-miR-497-5p	PAR-CLIP	24398324
MIRT046499	hsa-miR-15b-5p	PAR-CLIP	24398324
MIRT501086	hsa-miR-195-5p	PAR-CLIP	24398324
MIRT501085	hsa-miR-6838-5p	PAR-CLIP	24398324
MIRT501084	hsa-miR-503-5p	PAR-CLIP	24398324
MIRT501083	hsa-miR-595	PAR-CLIP	24398324
MIRT501082	hsa-miR-510-5p	PAR-CLIP	24398324
MIRT501081	hsa-miR-646	PAR-CLIP	24398324
MIRT501080	hsa-miR-1244	PAR-CLIP	24398324
MIRT501079	hsa-miR-3973	PAR-CLIP	24398324
MIRT501078	hsa-miR-545-3p	PAR-CLIP	24398324
MIRT501077	hsa-miR-4768-3p	PAR-CLIP	24398324
MIRT501076	hsa-miR-4459	PAR-CLIP	24398324
MIRT501075	hsa-miR-4433a-3p	PAR-CLIP	24398324
MIRT501074	hsa-miR-3664-3p	PAR-CLIP	24398324
MIRT501073	hsa-miR-4795-5p	PAR-CLIP	24398324
MIRT501072	hsa-miR-766-5p	PAR-CLIP	24398324
MIRT501071	hsa-miR-6735-3p	PAR-CLIP	24398324
MIRT501070	hsa-miR-663b	PAR-CLIP	24398324
MIRT501069	hsa-miR-644a	PAR-CLIP	24398324
MIRT501068	hsa-miR-4524a-5p	PAR-CLIP	24398324
MIRT501067	hsa-miR-4524b-5p	PAR-CLIP	24398324
MIRT501066	hsa-miR-3616-5p	PAR-CLIP	24398324
MIRT501065	hsa-miR-573	PAR-CLIP	24398324
MIRT501064	hsa-miR-7108-5p	PAR-CLIP	24398324
MIRT501063	hsa-miR-374b-3p	PAR-CLIP	24398324
MIRT439587	hsa-miR-376a-3p	HITS-CLIP	24374217
MIRT439586	hsa-miR-544a	HITS-CLIP	24374217
MIRT439587	hsa-miR-376a-3p	HITS-CLIP	24374217
MIRT439586	hsa-miR-544a	HITS-CLIP	24374217
MIRT049511	hsa-miR-92a-3p	HITS-CLIP	22473208
MIRT726492	hsa-miR-92b-3p	HITS-CLIP	22473208
MIRT726491	hsa-miR-32-5p	HITS-CLIP	22473208
MIRT731249	hsa-miR-185-5p	Luciferase reporter assay, qRT-PCR, Western blot	26390174
MIRT731249	hsa-miR-185-5p	Luciferase reporter assay, qRT-PCR, Western blot	26390174
MIRT731249	hsa-miR-185-5p	Luciferase reporter assay, qRT-PCR, Western blot	26390174
MIRT731249	hsa-miR-185-5p	Luciferase reporter assay, qRT-PCR, Western blot	26390174
MIRT501086	hsa-miR-195-5p	Luciferase reporter assay	26837421
MIRT501086	hsa-miR-195-5p	Luciferase reporter assay	26837421
MIRT501088	hsa-miR-424-5p	Luciferase reporter assay, qRT-PCR, Western blot	27628042
MIRT726492	hsa-miR-92b-3p	Luciferase reporter assay	27100897
MIRT726492	hsa-miR-92b-3p	Luciferase reporter assay	27100897
MIRT080118	hsa-miR-33a-3p	qRT-PCR, Western blot	25880168
MIRT007362	hsa-miR-21-5p	Luciferase reporter assay	28192117
MIRT007362	hsa-miR-21-5p	Luciferase reporter assay	28192117
MIRT501086	hsa-miR-195-5p	Luciferase reporter assay, qRT-PCR, Western blot	27574009
MIRT007362	hsa-miR-21-5p	Luciferase reporter assay, Western blot	26575121
MIRT007362	hsa-miR-21-5p	Luciferase reporter assay	28192117
MIRT007362	hsa-miR-21-5p	Luciferase reporter assay	28192117
MIRT007362	hsa-miR-21-5p	Luciferase reporter assay	28192117
MIRT007362	hsa-miR-21-5p	Luciferase reporter assay	28192117
MIRT007362	hsa-miR-21-5p	Luciferase reporter assay	28192117
MIRT007362	hsa-miR-21-5p	Luciferase reporter assay	28192117
MIRT501087	hsa-miR-497-5p	Luciferase reporter assay, qRT-PCR, Western blot	27303812
MIRT501084	hsa-miR-503-5p	Immunofluorescence, Luciferase reporter assay, qRT-PCR	32648079
MIRT007362	hsa-miR-21-5p	Luciferase reporter assay, qRT-PCR	34254453
MIRT734796	hsa-miR-21-3p	Luciferase reporter assay, Western blotting, qRT-PCR	33763375
MIRT735780	hsa-miR-216a-3p	Luciferase reporter assay, Western blotting, Immunofluorescence, qRT-PCR	31798627
MIRT735785	hsa-miR-107	Western blotting, qRT-PCR	32606425
MIRT501084	hsa-miR-503-5p	Luciferase reporter assay, Western blotting, qRT-PCR, Flow cytometry, ELISA	33872218
MIRT053873	hsa-miR-106b-5p	Luciferase reporter assay, Western blotting, qRT-PCR	31617643
MIRT734796	hsa-miR-21-3p	Luciferase reporter assay, Western blotting, Immunoprecipitaion (IP), qRT-PCR	31554487
MIRT736953	hsa-miR-106a-3p	Luciferase reporter assay, Western blotting, Immunohistochemistry (IHC), qRT-PCR, In situ hybridization, Flow cytometry	32267797
MIRT734796	hsa-miR-21-3p	Western blotting, Microarray, Immunohistochemistry (IHC), RNA-seq, qRT-PCR, Flow cytometry	33763375
MIRT735785	hsa-miR-107	Western blotting, RNA-seq, qRT-PCR	32606425
MIRT501089	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT501088	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT031521	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT501087	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT046499	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT501086	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT501085	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT501084	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT501083	hsa-miR-595	PAR-CLIP	20371350
MIRT501082	hsa-miR-510-5p	PAR-CLIP	20371350
MIRT501081	hsa-miR-646	PAR-CLIP	20371350
MIRT501080	hsa-miR-1244	PAR-CLIP	20371350
MIRT501079	hsa-miR-3973	PAR-CLIP	20371350
MIRT501078	hsa-miR-545-3p	PAR-CLIP	20371350
MIRT501077	hsa-miR-4768-3p	PAR-CLIP	20371350
MIRT501076	hsa-miR-4459	PAR-CLIP	20371350
MIRT501075	hsa-miR-4433a-3p	PAR-CLIP	20371350
MIRT501074	hsa-miR-3664-3p	PAR-CLIP	20371350
MIRT501073	hsa-miR-4795-5p	PAR-CLIP	20371350
MIRT501072	hsa-miR-766-5p	PAR-CLIP	20371350
MIRT501071	hsa-miR-6735-3p	PAR-CLIP	20371350
MIRT501070	hsa-miR-663b	PAR-CLIP	20371350
MIRT501069	hsa-miR-644a	PAR-CLIP	20371350
MIRT501068	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT501067	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT501066	hsa-miR-3616-5p	PAR-CLIP	20371350
MIRT501065	hsa-miR-573	PAR-CLIP	20371350
MIRT501064	hsa-miR-7108-5p	PAR-CLIP	20371350
MIRT501063	hsa-miR-374b-3p	PAR-CLIP	20371350
MIRT501089	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT501088	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT031521	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT501087	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT046499	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT501086	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT501085	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT501084	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT501083	hsa-miR-595	PAR-CLIP	20371350
MIRT501082	hsa-miR-510-5p	PAR-CLIP	20371350
MIRT501081	hsa-miR-646	PAR-CLIP	20371350
MIRT501080	hsa-miR-1244	PAR-CLIP	20371350
MIRT501079	hsa-miR-3973	PAR-CLIP	20371350
MIRT501078	hsa-miR-545-3p	PAR-CLIP	20371350
MIRT501077	hsa-miR-4768-3p	PAR-CLIP	20371350
MIRT501076	hsa-miR-4459	PAR-CLIP	20371350
MIRT501075	hsa-miR-4433a-3p	PAR-CLIP	20371350
MIRT501074	hsa-miR-3664-3p	PAR-CLIP	20371350
MIRT501073	hsa-miR-4795-5p	PAR-CLIP	20371350
MIRT501072	hsa-miR-766-5p	PAR-CLIP	20371350
MIRT501071	hsa-miR-6735-3p	PAR-CLIP	20371350
MIRT501070	hsa-miR-663b	PAR-CLIP	20371350
MIRT501069	hsa-miR-644a	PAR-CLIP	20371350
MIRT501068	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT501067	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT501066	hsa-miR-3616-5p	PAR-CLIP	20371350
MIRT501065	hsa-miR-573	PAR-CLIP	20371350
MIRT501064	hsa-miR-7108-5p	PAR-CLIP	20371350
MIRT501063	hsa-miR-374b-3p	PAR-CLIP	20371350
MIRT501089	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT501088	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT031521	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT501087	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT046499	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT501086	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT501085	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT501084	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT501083	hsa-miR-595	PAR-CLIP	20371350
MIRT501082	hsa-miR-510-5p	PAR-CLIP	20371350
MIRT501081	hsa-miR-646	PAR-CLIP	20371350
MIRT501080	hsa-miR-1244	PAR-CLIP	20371350
MIRT501079	hsa-miR-3973	PAR-CLIP	20371350
MIRT501078	hsa-miR-545-3p	PAR-CLIP	20371350
MIRT501077	hsa-miR-4768-3p	PAR-CLIP	20371350
MIRT501076	hsa-miR-4459	PAR-CLIP	20371350
MIRT501075	hsa-miR-4433a-3p	PAR-CLIP	20371350
MIRT501074	hsa-miR-3664-3p	PAR-CLIP	20371350
MIRT501073	hsa-miR-4795-5p	PAR-CLIP	20371350
MIRT501072	hsa-miR-766-5p	PAR-CLIP	20371350
MIRT501071	hsa-miR-6735-3p	PAR-CLIP	20371350
MIRT501070	hsa-miR-663b	PAR-CLIP	20371350
MIRT501069	hsa-miR-644a	PAR-CLIP	20371350
MIRT501068	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT501067	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT501066	hsa-miR-3616-5p	PAR-CLIP	20371350
MIRT501065	hsa-miR-573	PAR-CLIP	20371350
MIRT501064	hsa-miR-7108-5p	PAR-CLIP	20371350
MIRT501063	hsa-miR-374b-3p	PAR-CLIP	20371350
MIRT501089	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT501088	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT031521	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT501087	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT046499	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT501086	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT501085	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT501084	hsa-miR-503-5p	PAR-CLIP	21572407
MIRT501083	hsa-miR-595	PAR-CLIP	21572407
MIRT501082	hsa-miR-510-5p	PAR-CLIP	21572407
MIRT501081	hsa-miR-646	PAR-CLIP	21572407
MIRT501080	hsa-miR-1244	PAR-CLIP	21572407
MIRT501079	hsa-miR-3973	PAR-CLIP	21572407
MIRT501078	hsa-miR-545-3p	PAR-CLIP	21572407
MIRT501077	hsa-miR-4768-3p	PAR-CLIP	21572407
MIRT501076	hsa-miR-4459	PAR-CLIP	21572407
MIRT501075	hsa-miR-4433a-3p	PAR-CLIP	21572407
MIRT501074	hsa-miR-3664-3p	PAR-CLIP	21572407
MIRT501073	hsa-miR-4795-5p	PAR-CLIP	21572407
MIRT501072	hsa-miR-766-5p	PAR-CLIP	21572407
MIRT501071	hsa-miR-6735-3p	PAR-CLIP	21572407
MIRT501070	hsa-miR-663b	PAR-CLIP	21572407
MIRT501069	hsa-miR-644a	PAR-CLIP	21572407
MIRT501068	hsa-miR-4524a-5p	PAR-CLIP	21572407
MIRT501067	hsa-miR-4524b-5p	PAR-CLIP	21572407
MIRT501066	hsa-miR-3616-5p	PAR-CLIP	21572407
MIRT501065	hsa-miR-573	PAR-CLIP	21572407
MIRT501064	hsa-miR-7108-5p	PAR-CLIP	21572407
MIRT501063	hsa-miR-374b-3p	PAR-CLIP	21572407
MIRT501089	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT501088	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT031521	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT501087	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT046499	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT501086	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT501085	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT501084	hsa-miR-503-5p	PAR-CLIP	23446348
MIRT501083	hsa-miR-595	PAR-CLIP	23446348
MIRT501082	hsa-miR-510-5p	PAR-CLIP	23446348
MIRT501081	hsa-miR-646	PAR-CLIP	23446348
MIRT501080	hsa-miR-1244	PAR-CLIP	23446348
MIRT501079	hsa-miR-3973	PAR-CLIP	23446348
MIRT501078	hsa-miR-545-3p	PAR-CLIP	23446348
MIRT501077	hsa-miR-4768-3p	PAR-CLIP	23446348
MIRT501076	hsa-miR-4459	PAR-CLIP	23446348
MIRT501075	hsa-miR-4433a-3p	PAR-CLIP	23446348
MIRT501073	hsa-miR-4795-5p	PAR-CLIP	23446348
MIRT501072	hsa-miR-766-5p	PAR-CLIP	23446348
MIRT501071	hsa-miR-6735-3p	PAR-CLIP	23446348
MIRT501070	hsa-miR-663b	PAR-CLIP	23446348
MIRT501069	hsa-miR-644a	PAR-CLIP	23446348
MIRT501068	hsa-miR-4524a-5p	PAR-CLIP	23446348
MIRT501067	hsa-miR-4524b-5p	PAR-CLIP	23446348
MIRT501066	hsa-miR-3616-5p	PAR-CLIP	23446348
MIRT501065	hsa-miR-573	PAR-CLIP	23446348
MIRT501064	hsa-miR-7108-5p	PAR-CLIP	23446348
MIRT501063	hsa-miR-374b-3p	PAR-CLIP	23446348
MIRT501089	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT501088	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT031521	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT501087	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT046499	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT501086	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT501085	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT501084	hsa-miR-503-5p	PAR-CLIP	23446348
MIRT501083	hsa-miR-595	PAR-CLIP	23446348
MIRT501081	hsa-miR-646	PAR-CLIP	23446348
MIRT501080	hsa-miR-1244	PAR-CLIP	23446348
MIRT501079	hsa-miR-3973	PAR-CLIP	23446348
MIRT501078	hsa-miR-545-3p	PAR-CLIP	23446348
MIRT501077	hsa-miR-4768-3p	PAR-CLIP	23446348
MIRT501076	hsa-miR-4459	PAR-CLIP	23446348
MIRT501075	hsa-miR-4433a-3p	PAR-CLIP	23446348
MIRT501074	hsa-miR-3664-3p	PAR-CLIP	23446348
MIRT501073	hsa-miR-4795-5p	PAR-CLIP	23446348
MIRT501072	hsa-miR-766-5p	PAR-CLIP	23446348
MIRT501071	hsa-miR-6735-3p	PAR-CLIP	23446348
MIRT501070	hsa-miR-663b	PAR-CLIP	23446348
MIRT501069	hsa-miR-644a	PAR-CLIP	23446348
MIRT501068	hsa-miR-4524a-5p	PAR-CLIP	23446348
MIRT501067	hsa-miR-4524b-5p	PAR-CLIP	23446348
MIRT501066	hsa-miR-3616-5p	PAR-CLIP	23446348
MIRT501065	hsa-miR-573	PAR-CLIP	23446348
MIRT501064	hsa-miR-7108-5p	PAR-CLIP	23446348
MIRT501063	hsa-miR-374b-3p	PAR-CLIP	23446348
MIRT501089	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT501088	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT031521	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT501087	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT046499	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT501086	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT501085	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT501084	hsa-miR-503-5p	PAR-CLIP	23446348
MIRT501083	hsa-miR-595	PAR-CLIP	23446348
MIRT501082	hsa-miR-510-5p	PAR-CLIP	23446348
MIRT501081	hsa-miR-646	PAR-CLIP	23446348
MIRT501080	hsa-miR-1244	PAR-CLIP	23446348
MIRT501079	hsa-miR-3973	PAR-CLIP	23446348
MIRT501078	hsa-miR-545-3p	PAR-CLIP	23446348
MIRT501077	hsa-miR-4768-3p	PAR-CLIP	23446348
MIRT501076	hsa-miR-4459	PAR-CLIP	23446348
MIRT501075	hsa-miR-4433a-3p	PAR-CLIP	23446348
MIRT501074	hsa-miR-3664-3p	PAR-CLIP	23446348
MIRT501073	hsa-miR-4795-5p	PAR-CLIP	23446348
MIRT501072	hsa-miR-766-5p	PAR-CLIP	23446348
MIRT501071	hsa-miR-6735-3p	PAR-CLIP	23446348
MIRT501070	hsa-miR-663b	PAR-CLIP	23446348
MIRT501069	hsa-miR-644a	PAR-CLIP	23446348
MIRT501068	hsa-miR-4524a-5p	PAR-CLIP	23446348
MIRT501067	hsa-miR-4524b-5p	PAR-CLIP	23446348
MIRT501066	hsa-miR-3616-5p	PAR-CLIP	23446348
MIRT501065	hsa-miR-573	PAR-CLIP	23446348
MIRT501064	hsa-miR-7108-5p	PAR-CLIP	23446348
MIRT501063	hsa-miR-374b-3p	PAR-CLIP	23446348
MIRT501089	hsa-miR-15a-5p	PAR-CLIP	24398324
MIRT501088	hsa-miR-424-5p	PAR-CLIP	24398324
MIRT031521	hsa-miR-16-5p	PAR-CLIP	24398324
MIRT501087	hsa-miR-497-5p	PAR-CLIP	24398324
MIRT046499	hsa-miR-15b-5p	PAR-CLIP	24398324
MIRT501086	hsa-miR-195-5p	PAR-CLIP	24398324
MIRT501085	hsa-miR-6838-5p	PAR-CLIP	24398324
MIRT501084	hsa-miR-503-5p	PAR-CLIP	24398324
MIRT501083	hsa-miR-595	PAR-CLIP	24398324
MIRT501082	hsa-miR-510-5p	PAR-CLIP	24398324
MIRT501081	hsa-miR-646	PAR-CLIP	24398324
MIRT501080	hsa-miR-1244	PAR-CLIP	24398324
MIRT501079	hsa-miR-3973	PAR-CLIP	24398324
MIRT501078	hsa-miR-545-3p	PAR-CLIP	24398324
MIRT501077	hsa-miR-4768-3p	PAR-CLIP	24398324
MIRT501076	hsa-miR-4459	PAR-CLIP	24398324
MIRT501075	hsa-miR-4433a-3p	PAR-CLIP	24398324
MIRT501074	hsa-miR-3664-3p	PAR-CLIP	24398324
MIRT501073	hsa-miR-4795-5p	PAR-CLIP	24398324
MIRT501072	hsa-miR-766-5p	PAR-CLIP	24398324
MIRT501071	hsa-miR-6735-3p	PAR-CLIP	24398324
MIRT501070	hsa-miR-663b	PAR-CLIP	24398324
MIRT501069	hsa-miR-644a	PAR-CLIP	24398324
MIRT501068	hsa-miR-4524a-5p	PAR-CLIP	24398324
MIRT501067	hsa-miR-4524b-5p	PAR-CLIP	24398324
MIRT501066	hsa-miR-3616-5p	PAR-CLIP	24398324
MIRT501065	hsa-miR-573	PAR-CLIP	24398324
MIRT501064	hsa-miR-7108-5p	PAR-CLIP	24398324
MIRT501063	hsa-miR-374b-3p	PAR-CLIP	24398324
MIRT1371091	hsa-miR-15a	CLIP-seq
MIRT1371092	hsa-miR-15b	CLIP-seq
MIRT1371093	hsa-miR-16	CLIP-seq
MIRT1371094	hsa-miR-195	CLIP-seq
MIRT1371095	hsa-miR-25	CLIP-seq
MIRT1371096	hsa-miR-32	CLIP-seq
MIRT1371097	hsa-miR-363	CLIP-seq
MIRT1371098	hsa-miR-3647-5p	CLIP-seq
MIRT1371099	hsa-miR-367	CLIP-seq
MIRT1371100	hsa-miR-424	CLIP-seq
MIRT1371101	hsa-miR-4433	CLIP-seq
MIRT1371102	hsa-miR-4524	CLIP-seq
MIRT1371103	hsa-miR-4643	CLIP-seq
MIRT1371104	hsa-miR-466	CLIP-seq
MIRT1371105	hsa-miR-4789-3p	CLIP-seq
MIRT1371106	hsa-miR-4789-5p	CLIP-seq
MIRT1371107	hsa-miR-497	CLIP-seq
MIRT1371108	hsa-miR-503	CLIP-seq
MIRT1371109	hsa-miR-510	CLIP-seq
MIRT1371110	hsa-miR-545	CLIP-seq
MIRT1371111	hsa-miR-578	CLIP-seq
MIRT1371112	hsa-miR-92a	CLIP-seq
MIRT1371113	hsa-miR-92b	CLIP-seq
MIRT1371114	hsa-miR-1206	CLIP-seq
MIRT1371115	hsa-miR-1207-5p	CLIP-seq
MIRT1371116	hsa-miR-1266	CLIP-seq
MIRT1371117	hsa-miR-1322	CLIP-seq
MIRT1371118	hsa-miR-181a	CLIP-seq
MIRT1371119	hsa-miR-181b	CLIP-seq
MIRT1371120	hsa-miR-181c	CLIP-seq
MIRT1371121	hsa-miR-181d	CLIP-seq
MIRT1371122	hsa-miR-1909	CLIP-seq
MIRT1371095	hsa-miR-25	CLIP-seq
MIRT1371123	hsa-miR-3131	CLIP-seq
MIRT1371124	hsa-miR-3163	CLIP-seq
MIRT1371096	hsa-miR-32	CLIP-seq
MIRT1371125	hsa-miR-330-3p	CLIP-seq
MIRT1371126	hsa-miR-340	CLIP-seq
MIRT1371127	hsa-miR-3591-3p	CLIP-seq
MIRT1371128	hsa-miR-3613-3p	CLIP-seq
MIRT1371097	hsa-miR-363	CLIP-seq
MIRT1371099	hsa-miR-367	CLIP-seq
MIRT1371129	hsa-miR-371-5p	CLIP-seq
MIRT1371130	hsa-miR-371b-5p	CLIP-seq
MIRT1371131	hsa-miR-3926	CLIP-seq
MIRT1371132	hsa-miR-4262	CLIP-seq
MIRT1371133	hsa-miR-4270	CLIP-seq
MIRT1371134	hsa-miR-4441	CLIP-seq
MIRT1371135	hsa-miR-4468	CLIP-seq
MIRT1371136	hsa-miR-4518	CLIP-seq
MIRT1371103	hsa-miR-4643	CLIP-seq
MIRT1371104	hsa-miR-466	CLIP-seq
MIRT1371137	hsa-miR-4683	CLIP-seq
MIRT1371138	hsa-miR-4736	CLIP-seq
MIRT1371139	hsa-miR-4753-3p	CLIP-seq
MIRT1371140	hsa-miR-4763-3p	CLIP-seq
MIRT1371141	hsa-miR-4768-5p	CLIP-seq
MIRT1371105	hsa-miR-4789-3p	CLIP-seq
MIRT1371106	hsa-miR-4789-5p	CLIP-seq
MIRT1371142	hsa-miR-513a-3p	CLIP-seq
MIRT1371143	hsa-miR-548ad	CLIP-seq
MIRT1371144	hsa-miR-548s	CLIP-seq
MIRT1371111	hsa-miR-578	CLIP-seq
MIRT1371145	hsa-miR-580	CLIP-seq
MIRT1371146	hsa-miR-611	CLIP-seq
MIRT1371147	hsa-miR-665	CLIP-seq
MIRT1371112	hsa-miR-92a	CLIP-seq
MIRT1371113	hsa-miR-92b	CLIP-seq
MIRT1371148	hsa-miR-942	CLIP-seq
MIRT1371115	hsa-miR-1207-5p	CLIP-seq
MIRT1371149	hsa-miR-1226	CLIP-seq
MIRT1371122	hsa-miR-1909	CLIP-seq
MIRT1371150	hsa-miR-2964a-5p	CLIP-seq
MIRT1371151	hsa-miR-3144-5p	CLIP-seq
MIRT1371152	hsa-miR-3148	CLIP-seq
MIRT1371153	hsa-miR-3160-3p	CLIP-seq
MIRT1371124	hsa-miR-3163	CLIP-seq
MIRT1371154	hsa-miR-3175	CLIP-seq
MIRT1371155	hsa-miR-3183	CLIP-seq
MIRT1371156	hsa-miR-3184	CLIP-seq
MIRT1371157	hsa-miR-3191	CLIP-seq
MIRT1371126	hsa-miR-340	CLIP-seq
MIRT1371158	hsa-miR-342-3p	CLIP-seq
MIRT1371159	hsa-miR-3616-3p	CLIP-seq
MIRT1371160	hsa-miR-377	CLIP-seq
MIRT1371161	hsa-miR-3929	CLIP-seq
MIRT1371162	hsa-miR-423-5p	CLIP-seq
MIRT1371163	hsa-miR-4263	CLIP-seq
MIRT1371164	hsa-miR-4419b	CLIP-seq
MIRT1371165	hsa-miR-4436b-3p	CLIP-seq
MIRT1371166	hsa-miR-4478	CLIP-seq
MIRT1371167	hsa-miR-4487	CLIP-seq
MIRT1371168	hsa-miR-4497	CLIP-seq
MIRT1371169	hsa-miR-4514	CLIP-seq
MIRT1371170	hsa-miR-4652-5p	CLIP-seq
MIRT1371171	hsa-miR-4667-5p	CLIP-seq
MIRT1371172	hsa-miR-4668-5p	CLIP-seq
MIRT1371173	hsa-miR-4685-5p	CLIP-seq
MIRT1371174	hsa-miR-4692	CLIP-seq
MIRT1371175	hsa-miR-4699-3p	CLIP-seq
MIRT1371176	hsa-miR-4700-5p	CLIP-seq
MIRT1371177	hsa-miR-4723-3p	CLIP-seq
MIRT1371178	hsa-miR-4731-5p	CLIP-seq
MIRT1371179	hsa-miR-4733-3p	CLIP-seq
MIRT1371140	hsa-miR-4763-3p	CLIP-seq
MIRT1371180	hsa-miR-4803	CLIP-seq
MIRT1371181	hsa-miR-483-3p	CLIP-seq
MIRT1371182	hsa-miR-485-5p	CLIP-seq
MIRT1371183	hsa-miR-548ac	CLIP-seq
MIRT1371143	hsa-miR-548ad	CLIP-seq
MIRT1371184	hsa-miR-548d-3p	CLIP-seq
MIRT1371185	hsa-miR-548z	CLIP-seq
MIRT1371186	hsa-miR-558	CLIP-seq
MIRT1371187	hsa-miR-576-5p	CLIP-seq
MIRT1371188	hsa-miR-603	CLIP-seq
MIRT1371189	hsa-miR-940	CLIP-seq
MIRT1371129	hsa-miR-371-5p	CLIP-seq
MIRT1371130	hsa-miR-371b-5p	CLIP-seq
MIRT1371169	hsa-miR-4514	CLIP-seq
MIRT1371174	hsa-miR-4692	CLIP-seq
MIRT2110145	hsa-miR-1288	CLIP-seq
MIRT2110146	hsa-miR-3199	CLIP-seq
MIRT2110147	hsa-miR-1262	CLIP-seq
MIRT2110148	hsa-miR-4701-3p	CLIP-seq
MIRT1371115	hsa-miR-1207-5p	CLIP-seq
MIRT1371149	hsa-miR-1226	CLIP-seq
MIRT2110147	hsa-miR-1262	CLIP-seq
MIRT2333675	hsa-miR-1263	CLIP-seq
MIRT1371116	hsa-miR-1266	CLIP-seq
MIRT1371091	hsa-miR-15a	CLIP-seq
MIRT1371092	hsa-miR-15b	CLIP-seq
MIRT1371093	hsa-miR-16	CLIP-seq
MIRT1371118	hsa-miR-181a	CLIP-seq
MIRT1371119	hsa-miR-181b	CLIP-seq
MIRT1371120	hsa-miR-181c	CLIP-seq
MIRT1371121	hsa-miR-181d	CLIP-seq
MIRT1371122	hsa-miR-1909	CLIP-seq
MIRT1371094	hsa-miR-195	CLIP-seq
MIRT2333676	hsa-miR-200b	CLIP-seq
MIRT2333677	hsa-miR-200c	CLIP-seq
MIRT2333678	hsa-miR-2392	CLIP-seq
MIRT2333679	hsa-miR-2682	CLIP-seq
MIRT1371150	hsa-miR-2964a-5p	CLIP-seq
MIRT1371153	hsa-miR-3160-3p	CLIP-seq
MIRT1371154	hsa-miR-3175	CLIP-seq
MIRT1371156	hsa-miR-3184	CLIP-seq
MIRT2333680	hsa-miR-3189-3p	CLIP-seq
MIRT2333681	hsa-miR-3200-3p	CLIP-seq
MIRT2333682	hsa-miR-33a	CLIP-seq
MIRT2333683	hsa-miR-33b	CLIP-seq
MIRT2333684	hsa-miR-34a	CLIP-seq
MIRT2333685	hsa-miR-34c-5p	CLIP-seq
MIRT1371159	hsa-miR-3616-3p	CLIP-seq
MIRT2333686	hsa-miR-3646	CLIP-seq
MIRT1371161	hsa-miR-3929	CLIP-seq
MIRT2333687	hsa-miR-3940-5p	CLIP-seq
MIRT2333688	hsa-miR-3942-5p	CLIP-seq
MIRT1371162	hsa-miR-423-5p	CLIP-seq
MIRT1371100	hsa-miR-424	CLIP-seq
MIRT1371132	hsa-miR-4262	CLIP-seq
MIRT1371163	hsa-miR-4263	CLIP-seq
MIRT1371133	hsa-miR-4270	CLIP-seq
MIRT2333689	hsa-miR-429	CLIP-seq
MIRT2333690	hsa-miR-4300	CLIP-seq
MIRT2333691	hsa-miR-4318	CLIP-seq
MIRT1371164	hsa-miR-4419b	CLIP-seq
MIRT1371101	hsa-miR-4433	CLIP-seq
MIRT1371165	hsa-miR-4436b-3p	CLIP-seq
MIRT1371134	hsa-miR-4441	CLIP-seq
MIRT1371166	hsa-miR-4478	CLIP-seq
MIRT1371167	hsa-miR-4487	CLIP-seq
MIRT2333692	hsa-miR-449a	CLIP-seq
MIRT2333693	hsa-miR-449b	CLIP-seq
MIRT2333694	hsa-miR-449c	CLIP-seq
MIRT2333695	hsa-miR-4507	CLIP-seq
MIRT1371169	hsa-miR-4514	CLIP-seq
MIRT1371136	hsa-miR-4518	CLIP-seq
MIRT1371102	hsa-miR-4524	CLIP-seq
MIRT2333696	hsa-miR-4663	CLIP-seq
MIRT1371137	hsa-miR-4683	CLIP-seq
MIRT1371173	hsa-miR-4685-5p	CLIP-seq
MIRT2333697	hsa-miR-4690-5p	CLIP-seq
MIRT1371174	hsa-miR-4692	CLIP-seq
MIRT2333698	hsa-miR-4693-5p	CLIP-seq
MIRT2110148	hsa-miR-4701-3p	CLIP-seq
MIRT2333699	hsa-miR-4703-5p	CLIP-seq
MIRT2333700	hsa-miR-4729	CLIP-seq
MIRT1371179	hsa-miR-4733-3p	CLIP-seq
MIRT2333701	hsa-miR-4757-3p	CLIP-seq
MIRT1371140	hsa-miR-4763-3p	CLIP-seq
MIRT2333702	hsa-miR-4792	CLIP-seq
MIRT1371182	hsa-miR-485-5p	CLIP-seq
MIRT1371107	hsa-miR-497	CLIP-seq
MIRT1371108	hsa-miR-503	CLIP-seq
MIRT1371109	hsa-miR-510	CLIP-seq
MIRT2333703	hsa-miR-512-3p	CLIP-seq
MIRT2333704	hsa-miR-543	CLIP-seq
MIRT1371110	hsa-miR-545	CLIP-seq
MIRT1371186	hsa-miR-558	CLIP-seq
MIRT1371187	hsa-miR-576-5p	CLIP-seq
MIRT1371147	hsa-miR-665	CLIP-seq
MIRT2333705	hsa-miR-892a	CLIP-seq
MIRT2333706	hsa-miR-920	CLIP-seq
MIRT1371189	hsa-miR-940	CLIP-seq
MIRT2333707	hsa-miR-500a	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
FOS	Activation	15579469
HDAC1	Unknown	24369345
JUN	Activation	15579469
MTA1	Repression	22841502
SKIL	Repression	23154975
SMAD3	Repression	12761881
SMAD3	Unknown	10559222;10823886
SMAD4	Unknown	10559222;10823886
YY1	Unknown	24369345

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	17438144
GO:0000785	Component	Chromatin	ISA
GO:0001650	Component	Fibrillar center	IDA
GO:0001657	Process	Ureteric bud development	IEA
GO:0002725	Process	Negative regulation of T cell cytokine production	IEA
GO:0002725	Process	Negative regulation of T cell cytokine production	ISS
GO:0003714	Function	Transcription corepressor activity	IDA	17438144
GO:0005515	Function	Protein binding	IPI	14993265, 15231748, 16601693, 16720724, 18593713, 18762808, 20937913, 21258410, 21791611, 22344298, 22921829, 25283809
GO:0005518	Function	Collagen binding	IEA
GO:0005634	Component	Nucleus	IDA	11278251, 12151385, 17438144
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005737	Component	Cytoplasm	IDA	11278251, 12151385, 17438144
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA	12151385
GO:0005912	Component	Adherens junction	IDA	18593713
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IDA	18593713
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IEA
GO:0008013	Function	Beta-catenin binding	IPI	18593713
GO:0009653	Process	Anatomical structure morphogenesis	IBA
GO:0010717	Process	Regulation of epithelial to mesenchymal transition	IMP	24887517
GO:0010719	Process	Negative regulation of epithelial to mesenchymal transition	TAS	19018011
GO:0010944	Process	Negative regulation of transcription by competitive promoter binding	IDA	17438144
GO:0017015	Process	Regulation of transforming growth factor beta receptor signaling pathway	IEA
GO:0030154	Process	Cell differentiation	IBA
GO:0030279	Process	Negative regulation of ossification	IEA
GO:0030336	Process	Negative regulation of cell migration	TAS	19018011
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	IDA	9256479, 11278251, 12151385, 17438144, 18762808
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	IEA
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	IMP	16601693, 21791611
GO:0030514	Process	Negative regulation of BMP signaling pathway	IDA	17438144
GO:0030514	Process	Negative regulation of BMP signaling pathway	IEA
GO:0030514	Process	Negative regulation of BMP signaling pathway	IEA
GO:0031503	Process	Protein-containing complex localization	IDA	18593713
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	11278251, 12151385, 16720724
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	TAS	11278251
GO:0032926	Process	Negative regulation of activin receptor signaling pathway	IDA	16720724
GO:0032926	Process	Negative regulation of activin receptor signaling pathway	IEA
GO:0032984	Process	Protein-containing complex disassembly	IDA	18593713
GO:0032991	Component	Protein-containing complex	IDA	23610558
GO:0032991	Component	Protein-containing complex	IEA
GO:0034333	Process	Adherens junction assembly	IMP	18593713
GO:0034616	Process	Response to laminar fluid shear stress	IEA
GO:0034616	Process	Response to laminar fluid shear stress	IEP	9256479
GO:0034713	Function	Type I transforming growth factor beta receptor binding	IEA
GO:0034713	Function	Type I transforming growth factor beta receptor binding	IPI	11278251
GO:0036064	Component	Ciliary basal body	IDA
GO:0036064	Component	Ciliary basal body	IEA
GO:0045596	Process	Negative regulation of cell differentiation	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048844	Process	Artery morphogenesis	IEA
GO:0048844	Process	Artery morphogenesis	ISS
GO:0050821	Process	Protein stabilization	IDA	18593713
GO:0055010	Process	Ventricular cardiac muscle tissue morphogenesis	IEA
GO:0055010	Process	Ventricular cardiac muscle tissue morphogenesis	ISS
GO:0055117	Process	Regulation of cardiac muscle contraction	IEA
GO:0055117	Process	Regulation of cardiac muscle contraction	ISS
GO:0060373	Process	Regulation of ventricular cardiac muscle cell membrane depolarization	IEA
GO:0060373	Process	Regulation of ventricular cardiac muscle cell membrane depolarization	ISS	18952608
GO:0060392	Process	Negative regulation of SMAD protein signal transduction	IDA	17438144
GO:0060392	Process	Negative regulation of SMAD protein signal transduction	IEA
GO:0060392	Process	Negative regulation of SMAD protein signal transduction	IMP	16601693
GO:0060392	Process	Negative regulation of SMAD protein signal transduction	ISS
GO:0060395	Process	SMAD protein signal transduction	IBA
GO:0060395	Process	SMAD protein signal transduction	IDA	18593713
GO:0060395	Process	SMAD protein signal transduction	IEA
GO:0060412	Process	Ventricular septum morphogenesis	IEA
GO:0060412	Process	Ventricular septum morphogenesis	ISS
GO:0070411	Function	I-SMAD binding	IBA
GO:0070411	Function	I-SMAD binding	IEA
GO:0070411	Function	I-SMAD binding	IPI	9256479
GO:0070697	Function	Activin receptor binding	IEA
GO:0070697	Function	Activin receptor binding	IPI	16720724
GO:0071144	Component	Heteromeric SMAD protein complex	IBA
GO:0071363	Process	Cellular response to growth factor stimulus	IEA
GO:0140416	Function	Transcription regulator inhibitor activity	IBA
GO:0140416	Function	Transcription regulator inhibitor activity	IDA	9256479
GO:0140416	Function	Transcription regulator inhibitor activity	IEA
GO:0141091	Process	Transforming growth factor beta receptor superfamily signaling pathway	IEA
GO:1902731	Process	Negative regulation of chondrocyte proliferation	IEA
GO:1903043	Process	Positive regulation of chondrocyte hypertrophy	IEA
GO:1904886	Process	Beta-catenin destruction complex disassembly	IDA	18593713
GO:1990756	Function	Ubiquitin-like ligase-substrate adaptor activity	IDA	11278251
GO:1990830	Process	Cellular response to leukemia inhibitory factor	IEA
GO:2000049	Process	Positive regulation of cell-cell adhesion mediated by cadherin	IDA	18593713
GO:2000049	Process	Positive regulation of cell-cell adhesion mediated by cadherin	IEA
GO:2000317	Process	Negative regulation of T-helper 17 type immune response	IEA
GO:2000317	Process	Negative regulation of T-helper 17 type immune response	ISS
GO:2000320	Process	Negative regulation of T-helper 17 cell differentiation	IEA
GO:2000320	Process	Negative regulation of T-helper 17 cell differentiation	ISS

Other IDs

• MIM: 602932
• HGNC: 6773
• e!Ensembl: ENSG00000101665

Protein

• UniProt ID: O15105
• Protein name: Mothers against decapentaplegic homolog 7 (MAD homolog 7) (Mothers against DPP homolog 7) (Mothers against decapentaplegic homolog 8) (MAD homolog 8) (Mothers against DPP homolog 8) (SMAD family member 7) (SMAD 7) (Smad7) (hSMAD7)
• Protein function: Antagonist of signaling by TGF-beta (transforming growth factor) type 1 receptor superfamily members; has been shown to inhibit TGF-beta (Transforming growth factor) and activin signaling by associating with their receptors thus preventing SMAD2
• PDB: 2DJY, 2KXQ, 2LTV, 2LTW, 2LTX, 2LTY, 2LTZ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03165	MH1	92 → 202	MH1 domain	Domain
  PF03166	MH2	259 → 424	MH2 domain	Family

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous with higher expression in the lung and vascular endothelium.
• Sequence:

  MFRTKRSALVRRLWRSRAPGGEDEEEGAGGGGGGGELRGEGATDSRAHGAGGGGPGRAGC
  CLGKAVRGAKGHHHPHPPAAGAGAAGGAEADLKALTHSVLKKLKERQLELLLQAVESRGG
  TRTACLLLPGRLDCRLGPGAPAGAQPAQPPSSYSLPLLLCKVFRWPDLRHSSEVKRLCCC
  ESYGKINPELVCCNPHHLSRLCELESPPPPYSRYPMDFLKPTADCPDAVPSSAETGGTNY
  LAPGGLSDSQLLLEPGDRSHWCVVAYWEEKTRVGRLYCVQEPSLDIFYDLPQGNGFCLGQ
  LNSDNKSQLVQKVRSKIGCGIQLTREVDGVWVYNRSSYPIFIKSATLDNPDSRTLLVHKV
  FPGFSIKAFDYEKAYSLQRPNDHEFMQQPWTGFTVQISFVKGWGQCYTRQFISSCPCWLE
  VIFNSR

• Sequence length: 426

Pathways

KEGG:

TGF-beta signaling pathway
Hippo signaling pathway

Reactome:

Signaling by BMP
Downregulation of TGF-beta receptor signaling
SMAD2/SMAD3:SMAD4 heterotrimer regulates transcription
Ub-specific processing proteases

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BENIGN NEOPLASM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIARY TRACT CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLON CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL ADENOCARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL ADENOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer, susceptibility to, 3	risk factor; Uncertain significance	ClinVar ClinVar, GenCC	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
COLORECTAL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL HEART DISEASE	—	ClinGen, ClinVar, Disgenet ClinGen, ClinVar, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATOCELLULAR CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary breast ovarian cancer syndrome	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-HODGKINS LYMPHOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN ENDOMETRIOID CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARAQUAT LUNG	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY FIBROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RECTUM CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SMAD7-related disorder	Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	18041647		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	28732737		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	25501921		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	24659668		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	15922743		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	GWASCAT_DG	17934461, 18372901, 21761138, 23266556, 24448986, 24836286, 25990418, 26151821, 26965516, 27207650, 29228715, 29471430, 29917119, 30104761, 30510241, 30529582, 31089142		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	GWASCAT_DG	30510241		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	28732737		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	20514018		★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	BEFREE	15885643		★☆☆☆☆ Found in Text Mining only
Alveolitis, Fibrosing	Alveolitis	CTD_human_DG	23590892		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	35366391	Associate	★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	31243343		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	31243343		★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	37833774	Associate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	15150118, 25867271		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	29366786, 29777793		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	27731365, 30450102		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	20628268	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	12464953		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	BEFREE	29366786, 29777793		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	33282009	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	CTD_human_DG	29892015, 30061737		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial Fibrillation	GWASCAT_DG	29892015, 30061737		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial Fibrillation	BEFREE	30683806		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	BEFREE	28167776, 31553906, 31796589		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	31968593	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	30535438		★☆☆☆☆ Found in Text Mining only
Bicuspid aortic valve	Bicuspid aortic valve	BEFREE	29176317		★☆☆☆☆ Found in Text Mining only
Bile Duct Diseases	Bile duct disease	Pubtator	19878580	Stimulate	★☆☆☆☆ Found in Text Mining only
Biliary hyperplasia	Biliary hyperplasia	BEFREE	27775690		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15661223, 24090133, 26531758, 27303812, 29893810, 30545440, 30594253		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	12947087, 23372687, 24090133, 27188720, 29893810, 30545440, 32856881, 34370213, 39337574	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	30594253	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	12947087, 24343358, 24969865, 29084532, 30229897, 31264769	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	32096163	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	20551054, 24659668, 9892110		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	16489684, 23991075, 25436421, 26989026, 28192402, 31264769	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	11719467, 21569311, 22421218, 28601662, 30017880, 30072581, 31767934		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	21768661	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	37746966	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	18024258		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	24394555, 25333457, 30158641, 31298312		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	36878974	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	33282009	Associate	★☆☆☆☆ Found in Text Mining only
Cat eye syndrome	Cat Eye Syndrome	BEFREE	29089751		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	29415065		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	19288000, 31815762		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	19288000, 31815762		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	28732737		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	23244128	Associate	★☆☆☆☆ Found in Text Mining only
Choroid Plexus Carcinoma	Choroid Plexus Carcinoma	BEFREE	22554650		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	28566468		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	18231913		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	21940491, 29456676		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	19192480, 22028324, 23155305, 23287011, 26818761, 29668937, 30315770, 30850474, 31553906		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	19357349, 20124488, 23435373, 23560096, 24556688, 26779637		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Diseases	Colonic disease	Pubtator	24969865	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	19155440	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	11391794, 12584741, 12866583, 17934461, 18231913, 19155440, 19341727, 19357349, 19395656, 20124488, 21221812, 21242260, 21910156, 22028324, 22367214, 22457752, 22580541, 23104301, 23275154, 23560096, 23875689, 23949881, 24066093, 24448986, 24480808, 24556688, 24557062, 24753543, 24969865, 25375357, 25640388, 26579801, 26779637, 27662660, 28070019, 28218435, 28300830, 28374902, 28467803, 29048575, 29084532, 29119627, 29986644, 30275229, 30498395, 31052449, 31434255		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	17934461		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Carcinoma	Colorectal Cancer	GWASDB_DG	17934461, 18372901, 19011631, 21761138, 23266556, 24448986, 24836286		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Carcinoma	Colorectal Cancer	GWASCAT_DG	17934461, 18372901, 21761138, 23266556, 24448986, 24836286, 25990418, 26151821, 26965516, 27207650, 29228715, 29471430, 29917119, 30104761, 30510241, 30529582, 31089142		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	17934461		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	17934461		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	GWASCAT_DG	17934461, 18372901, 21761138, 23266556, 24448986, 24836286, 25990418, 26151821, 26965516, 27207650, 29228715, 29471430, 29917119, 30104761, 30510241, 30529582, 31089142		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	18372901, 19155440, 19357349, 20124488, 20501757, 20648012, 21071539, 21119214, 21179028, 21910156, 22367214, 22457859, 22505654, 22580541, 22879968, 22999960, 23104301, 23560096, 24066093, 24448986, 24753543, 24969865, 25375357, 25640388, 25873010, 26779637, 27662660, 27769063, 28300830, 28374902, 28506205, 29084532, 29119627, 29986644, 31027226, 31434255, 32323793, 32324875, 32899503, 35016683, 35108261, 35812248, 36550779, 36657129, 38112776, 38146644, 38581999	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	29297384	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital heart disease	Congenital Heart Disease	BEFREE	24039762		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Corneal Diseases	Corneal Diseases	BEFREE	28339457		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	24039762		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	11518734, 16285943, 22252452, 22819866, 22971085, 23287011, 23489130, 27731365, 28838419, 28847751, 29051788, 29415065, 29668937, 30315770, 31068803, 31553906, 31850931		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	11518734, 31968593, 33076905, 33871807, 35263186, 35841457	Associate	★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	30342000		★☆☆☆☆ Found in Text Mining only
Cyclic neutropenia	Cyclic neutropenia	Pubtator	21189329	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	30423327		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	23436698	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	30936994		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	30936994		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	23637351	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	23637351		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	17931948, 31392590		★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	29138820		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	22211842, 24887517, 26415649, 30936994, 31655195		★☆☆☆☆ Found in Text Mining only
Digestive System Disorders	Digestive System Disorders	BEFREE	26989026		★☆☆☆☆ Found in Text Mining only
Duane Retraction Syndrome	Duane retraction syndrome	Pubtator	24047375	Associate	★☆☆☆☆ Found in Text Mining only
Duodenal Ulcer	Duodenal ulcer	Pubtator	21445336	Inhibit	★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	GWASCAT_DG	30595370		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	15661223		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	15661223		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	24394555, 30158641		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	25554686		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	25554686		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	25554686, 26078566	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	34725559	Inhibit	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	15736400, 27619676, 30611100, 36056599	Associate	★☆☆☆☆ Found in Text Mining only
Fibrodysplasia Ossificans Progressiva	Fibrodysplasia Ossificans Progressiva	BEFREE	18684712		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	14604812, 21177794		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	19878580, 22624557, 23405141, 26071245, 27396813, 27633729, 27775690, 29307832, 29311932, 31148365, 31412137, 31698731		★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	12397035		★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	23665284		★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	24659668		★☆☆☆☆ Found in Text Mining only
Gastrointestinal inflammation	Gastrointestinal inflammation	BEFREE	21910156		★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	19450457, 22876112	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	27473823		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	28735518	Inhibit	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	27473823		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	29212174, 31799673		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	19693466	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	11560950		★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	29415065		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	22641218	Associate	★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	24039762	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	36878974	Associate	★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	BEFREE	20863724		★☆☆☆☆ Found in Text Mining only
HEMOCHROMATOSIS, TYPE 1	Hemochromatosis	BEFREE	20863724		★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	10915727		★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	22960056, 25392930		★☆☆☆☆ Found in Text Mining only
Hereditary Nonpolyposis Colorectal Cancer	Colorectal Cancer	BEFREE	30275229		★☆☆☆☆ Found in Text Mining only
Hyperandrogenism	Hyperandrogenism	Pubtator	29116087	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	29196166		★☆☆☆☆ Found in Text Mining only
hypertensive nephropathy	Hypertensive Nephropathy	BEFREE	28808068		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	35346905, 35875936	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	37416778	Associate	★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	29327472		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	24556688		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	11518734, 12127716, 14600158, 16285943, 19192480, 22028324, 23155305, 23287011, 23489130, 29383027, 29973939, 29977289, 30147698, 31052449, 31553906		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	11518734, 14600158, 20944558, 32397546	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	30423327		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	29415065		★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	24556688		★☆☆☆☆ Found in Text Mining only
Intracranial Arteriovenous Malformations	Intracranial arteriovenous malformation	Pubtator	36198763	Stimulate	★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	22960056		★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	BEFREE	26015770		★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	26015770, 36160033	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	12397035, 21927575, 30936994, 31059771		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	22505654	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	28566468		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10828018		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	33780363	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	30177817		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	30185419		★☆☆☆☆ Found in Text Mining only
Lipoid nephrosis	Lipoid Nephrosis	BEFREE	12397035		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	11408948, 23625826, 25436421, 25602745, 26759305, 26989026, 27100897, 27702662, 28134936, 28192402, 28498453, 31554487, 31617643		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	31148365	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	28734833		★☆☆☆☆ Found in Text Mining only
Localized scleroderma	Scleroderma	BEFREE	17009056		★☆☆☆☆ Found in Text Mining only
Localized scleroderma	Scleroderma	LHGDN	17009056		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	30936994		★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	31085559	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	21569311, 34254453	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	31673979		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	12397035		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	15033661, 23244128	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	19341727, 30611100		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	30611100	Inhibit	★☆☆☆☆ Found in Text Mining only
Lynch Syndrome	Lynch Syndrome	BEFREE	30275229		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15661223, 24090133, 26531758, 27303812, 29893810, 30545440, 30594253		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	15661223		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	25554686		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	23998914		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of large intestine	Colorectal Neoplasms	GWASCAT_DG	17934461, 18372901, 21761138, 23266556, 24448986, 24836286, 25990418, 26151821, 26965516, 27207650, 29228715, 29471430, 29917119, 30104761, 30510241, 30529582, 31089142		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	28498453, 31711043		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11719467, 21221812, 21569311, 22421218, 28601662, 30072581, 31767934		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	30185419		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	11078792, 25333457, 31298312		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	10498890, 15150118		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	16550207, 29278879		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	19341727, 24185685, 24752577, 28400336, 30147341, 31146975		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15150118, 15661223, 19341727, 21075068, 21222648, 22028324, 22421218, 22614440, 24752577, 24969865, 26982322, 27185036, 27473228, 28874583, 29973939, 30017880, 30342000, 30594253		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	19288000, 31815762		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	GWASCAT_DG	17934461, 18372901, 21761138, 23266556, 24448986, 24836286, 25990418, 26151821, 26965516, 27207650, 29228715, 29471430, 29917119, 30104761, 30510241, 30529582, 31089142		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	19357349, 20124488, 23435373, 23560096, 24556688, 26779637		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	HPO_DG			★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	19505925		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	16007121, 17332363		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	20738806	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	30342000, 31201180		★☆☆☆☆ Found in Text Mining only
Membranous glomerulonephritis	Membranous Glomerulonephritis	BEFREE	12397035		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	27967316		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood disorder	Pubtator	33828235	Associate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	30078021		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	30078021	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	21093933, 31796589		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	21093933, 31968593	Associate	★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	23390194, 30015844		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	21189329	Inhibit	★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	30015844	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	30317569		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	35346905	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	37713818	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nasal Polyps	Nasal polyp	Pubtator	37382248	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	GWASDB_DG	20512145		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	26390174	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	30250517		★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	24343358	Stimulate	★☆☆☆☆ Found in Text Mining only
Necrotizing Enterocolitis	Necrotizing Enterocolitis	BEFREE	23154975		★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	23154975		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10498890, 11391794, 15661223, 20124488, 22286770, 22751114, 23104301, 23625826, 24185685, 24345480, 24480808, 25107916, 25333457, 25565012, 25602745, 25931269, 27041581, 27473228, 28134936, 28498453, 30036733, 30185419, 30219864, 30342000, 30423327, 30568467, 30611100, 31039140, 31243343, 31434255, 31554487		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	24345480		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	24345480	Associate	★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	26856334		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	27185036, 30568467		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	25501551		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	32108968	Associate	★☆☆☆☆ Found in Text Mining only
Oral Mucositis	Oral Mucositis	BEFREE	30185419		★☆☆☆☆ Found in Text Mining only
Osteonecrosis	Osteonecrosis	Pubtator	25060766	Associate	★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	31435709		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	30338786		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	30338786	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	16259979, 25107916, 31251735		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	31251735	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	24394555, 25333457, 31298312		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	24394555	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	10498890, 15150118		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	15150118, 16596258, 25867271		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	16714330		★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	27473228	Associate	★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	30219864		★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	18326816	Inhibit	★☆☆☆☆ Found in Text Mining only
Paroxysmal atrial fibrillation	Paroxysmal atrial fibrillation	CTD_human_DG	29892015, 30061737		★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic organ prolapse	Pubtator	29737911	Associate	★☆☆☆☆ Found in Text Mining only
Peyronie Disease	Peyronie Disease	BEFREE	25532569		★☆☆☆☆ Found in Text Mining only
Pituitary Adenoma	Pituitary adenoma	BEFREE	30973065		★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	24636138	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	30865275, 31735954		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	29886060		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	28732737		★☆☆☆☆ Found in Text Mining only
Prolactinoma	Prolactinoma	BEFREE	30946881		★☆☆☆☆ Found in Text Mining only
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	BEFREE	23258148, 29436636		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	16550207, 18762808, 29278879		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	15708859		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	15708859, 29278879	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	28580633		★☆☆☆☆ Found in Text Mining only
Pterygium	Pterygium	BEFREE	31774554		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	16707515, 19087346, 36217332	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	26496995		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	CTD_human_DG	23590892		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	25487928, 31085559	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	27292644		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pustulosis of Palms and Soles	Palmoplantar Pustules	BEFREE	15885643		★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	26779637		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	21927575, 22211842, 26415649, 26919280, 27161221, 28808068, 29102563, 29518614, 30212825		★☆☆☆☆ Found in Text Mining only
Renal glomerular disease	Renal Glomerular Disease	BEFREE	12397035		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	27731365, 30450102		★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	11904440, 12127716, 12847691, 14722617		★☆☆☆☆ Found in Text Mining only
Sinusitis	Sinusitis	Pubtator	37382248	Associate	★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	30219864		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	15885643		★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	38634365	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	26982322, 30036733		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	27619676, 29156846, 30611100		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	20462450	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	26982322	Inhibit	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	19341727, 24185685, 24752577, 28400336, 30147341, 31146975		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	15033661, 15609398, 24659668, 24752577, 35449150	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	32096163	Inhibit	★☆☆☆☆ Found in Text Mining only
Stomatitis	Stomatitis	BEFREE	30185419		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	11904440, 12127716, 12847691, 14722617		★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	24126800	Stimulate	★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	31243343	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	12952364		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	24126800	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	28674186, 31147529		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	28674186	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	30653987, 31553906		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uranostaphyloschisis	Uranostaphyloschisis	BEFREE	30548829		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	35982887	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	35791307	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	14604812, 21177794		★☆☆☆☆ Found in Text Mining only
Ventricular Septal Defects	Ventricular septal defect	BEFREE	18952608		★☆☆☆☆ Found in Text Mining only