ARRB2 (arrestin beta 2)

Gene

• Entrez ID: 409
• Gene name: Arrestin beta 2
• Gene symbol: ARRB2
• Synonyms (NCBI Gene): ARB2, ARR2, BARR2
• Chromosome: 17
• Chromosome location: 17p13.2
• Summary: Members of arrestin/beta-arrestin protein family are thought to participate in agonist-mediated desensitization of G-protein-coupled receptors and cause specific dampening of cellular responses to stimuli such as hormones, neurotransmitters, or sensory si

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT045486	hsa-miR-149-5p	CLASH	23622248
MIRT039876	hsa-miR-615-3p	CLASH	23622248
MIRT038258	hsa-miR-330-5p	CLASH	23622248
MIRT481458	hsa-miR-9500	PAR-CLIP	23592263
MIRT481457	hsa-miR-6783-5p	PAR-CLIP	23592263
MIRT481456	hsa-miR-125a-3p	PAR-CLIP	23592263
MIRT481455	hsa-miR-7515	PAR-CLIP	23592263
MIRT481454	hsa-miR-3184-5p	PAR-CLIP	23592263
MIRT481453	hsa-miR-423-5p	PAR-CLIP	23592263
MIRT481452	hsa-miR-1914-3p	PAR-CLIP	23592263
MIRT481451	hsa-miR-5194	PAR-CLIP	23592263
MIRT481450	hsa-miR-6738-5p	PAR-CLIP	23592263
MIRT481449	hsa-miR-2115-5p	PAR-CLIP	23592263
MIRT481448	hsa-miR-6077	PAR-CLIP	23592263
MIRT481447	hsa-miR-3202	PAR-CLIP	23592263
MIRT481445	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT481446	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT481444	hsa-miR-4271	PAR-CLIP	23592263
MIRT481443	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT481442	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT481441	hsa-miR-4710	PAR-CLIP	23592263
MIRT481440	hsa-miR-6734-5p	PAR-CLIP	23592263
MIRT116603	hsa-miR-6779-5p	PAR-CLIP	23592263
MIRT728304	hsa-miR-181a-5p	HITS-CLIP	22473208
MIRT728303	hsa-miR-181b-5p	HITS-CLIP	22473208
MIRT728302	hsa-miR-181c-5p	HITS-CLIP	22473208
MIRT728300	hsa-miR-181d-5p	HITS-CLIP	22473208
MIRT481458	hsa-miR-9500	PAR-CLIP	23592263
MIRT481457	hsa-miR-6783-5p	PAR-CLIP	23592263
MIRT481456	hsa-miR-125a-3p	PAR-CLIP	23592263
MIRT481455	hsa-miR-7515	PAR-CLIP	23592263
MIRT481454	hsa-miR-3184-5p	PAR-CLIP	23592263
MIRT481453	hsa-miR-423-5p	PAR-CLIP	23592263
MIRT481452	hsa-miR-1914-3p	PAR-CLIP	23592263
MIRT481451	hsa-miR-5194	PAR-CLIP	23592263
MIRT481450	hsa-miR-6738-5p	PAR-CLIP	23592263
MIRT481449	hsa-miR-2115-5p	PAR-CLIP	23592263
MIRT481448	hsa-miR-6077	PAR-CLIP	23592263
MIRT481447	hsa-miR-3202	PAR-CLIP	23592263
MIRT481445	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT481446	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT481444	hsa-miR-4271	PAR-CLIP	23592263
MIRT481443	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT481442	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT481441	hsa-miR-4710	PAR-CLIP	23592263
MIRT481440	hsa-miR-6734-5p	PAR-CLIP	23592263
MIRT116603	hsa-miR-6779-5p	PAR-CLIP	23592263
MIRT755378	hsa-miR-365a-3p	Luciferase reporter assay, Western blotting, qRT-PCR	35958620
MIRT800609	hsa-miR-3184	CLIP-seq
MIRT800610	hsa-miR-4492	CLIP-seq
MIRT800611	hsa-miR-4498	CLIP-seq
MIRT800612	hsa-miR-4505	CLIP-seq
MIRT800613	hsa-miR-762	CLIP-seq
MIRT800614	hsa-miR-1208	CLIP-seq
MIRT800615	hsa-miR-155	CLIP-seq
MIRT800616	hsa-miR-181a	CLIP-seq
MIRT800617	hsa-miR-181b	CLIP-seq
MIRT800618	hsa-miR-181c	CLIP-seq
MIRT800619	hsa-miR-181d	CLIP-seq
MIRT800620	hsa-miR-1908	CLIP-seq
MIRT800621	hsa-miR-3127-3p	CLIP-seq
MIRT800622	hsa-miR-3135b	CLIP-seq
MIRT800623	hsa-miR-3180-5p	CLIP-seq
MIRT800624	hsa-miR-3613-3p	CLIP-seq
MIRT800625	hsa-miR-3647-3p	CLIP-seq
MIRT800626	hsa-miR-365	CLIP-seq
MIRT800627	hsa-miR-3652	CLIP-seq
MIRT800628	hsa-miR-4262	CLIP-seq
MIRT800629	hsa-miR-4282	CLIP-seq
MIRT800630	hsa-miR-4291	CLIP-seq
MIRT800631	hsa-miR-4420	CLIP-seq
MIRT800632	hsa-miR-4430	CLIP-seq
MIRT800633	hsa-miR-4434	CLIP-seq
MIRT800610	hsa-miR-4492	CLIP-seq
MIRT800611	hsa-miR-4498	CLIP-seq
MIRT800634	hsa-miR-4508	CLIP-seq
MIRT800635	hsa-miR-4516	CLIP-seq
MIRT800636	hsa-miR-451b	CLIP-seq
MIRT800637	hsa-miR-4531	CLIP-seq
MIRT800638	hsa-miR-520a-5p	CLIP-seq
MIRT800639	hsa-miR-525-5p	CLIP-seq
MIRT800640	hsa-miR-545	CLIP-seq
MIRT800641	hsa-miR-558	CLIP-seq
MIRT800642	hsa-miR-663	CLIP-seq
MIRT800643	hsa-miR-744	CLIP-seq
MIRT800613	hsa-miR-762	CLIP-seq
MIRT800615	hsa-miR-155	CLIP-seq
MIRT800616	hsa-miR-181a	CLIP-seq
MIRT800617	hsa-miR-181b	CLIP-seq
MIRT800618	hsa-miR-181c	CLIP-seq
MIRT800619	hsa-miR-181d	CLIP-seq
MIRT1936492	hsa-miR-1825	CLIP-seq
MIRT1936493	hsa-miR-199a-5p	CLIP-seq
MIRT1936494	hsa-miR-199b-5p	CLIP-seq
MIRT1936495	hsa-miR-2115	CLIP-seq
MIRT800609	hsa-miR-3184	CLIP-seq
MIRT1936496	hsa-miR-3185	CLIP-seq
MIRT800626	hsa-miR-365	CLIP-seq
MIRT800628	hsa-miR-4262	CLIP-seq
MIRT800630	hsa-miR-4291	CLIP-seq
MIRT1936497	hsa-miR-4302	CLIP-seq
MIRT800610	hsa-miR-4492	CLIP-seq
MIRT800611	hsa-miR-4498	CLIP-seq
MIRT800612	hsa-miR-4505	CLIP-seq
MIRT800636	hsa-miR-451b	CLIP-seq
MIRT1936498	hsa-miR-4709-3p	CLIP-seq
MIRT800640	hsa-miR-545	CLIP-seq
MIRT800613	hsa-miR-762	CLIP-seq
MIRT1936495	hsa-miR-2115	CLIP-seq
MIRT800609	hsa-miR-3184	CLIP-seq
MIRT1936496	hsa-miR-3185	CLIP-seq
MIRT800610	hsa-miR-4492	CLIP-seq
MIRT800611	hsa-miR-4498	CLIP-seq
MIRT800612	hsa-miR-4505	CLIP-seq
MIRT800613	hsa-miR-762	CLIP-seq
MIRT1936495	hsa-miR-2115	CLIP-seq
MIRT800609	hsa-miR-3184	CLIP-seq
MIRT1936496	hsa-miR-3185	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001664	Function	G protein-coupled receptor binding	IDA	37209686, 38175886
GO:0001664	Function	G protein-coupled receptor binding	IPI	10644702
GO:0002029	Process	Desensitization of G protein-coupled receptor signaling pathway	IDA	37209686, 38175886
GO:0002029	Process	Desensitization of G protein-coupled receptor signaling pathway	IMP	12582207
GO:0002031	Process	G protein-coupled receptor internalization	IBA
GO:0002031	Process	G protein-coupled receptor internalization	IDA	10644702
GO:0002031	Process	G protein-coupled receptor internalization	IEA
GO:0002031	Process	G protein-coupled receptor internalization	IMP	12582207
GO:0002031	Process	G protein-coupled receptor internalization	TAS	24157794
GO:0002092	Process	Positive regulation of receptor internalization	IEA
GO:0002092	Process	Positive regulation of receptor internalization	IMP	22457824
GO:0005102	Function	Signaling receptor binding	IPI	18604210
GO:0005515	Function	Protein binding	IPI	12958365, 15125834, 16051150, 16378096, 16524428, 16820410, 17148612, 17620599, 19060904, 19122674, 19202075, 19363159, 19782076, 19955404, 20664520, 20802461, 22190034, 22282525, 22300987, 22457824, 23208550, 23341447, 23809162, 24157794, 24658140, 25241761, 25416956, 31515488, 319
GO:0005634	Component	Nucleus	IDA	16820410
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IC	26839314
GO:0005737	Component	Cytoplasm	IDA	12958365, 15611106, 16325578, 16820410, 23341447
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA	18604210
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	21149639
GO:0005905	Component	Clathrin-coated pit	IEA
GO:0006366	Process	Transcription by RNA polymerase II	IDA	16820410
GO:0007165	Process	Signal transduction	IEA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IDA	12958365
GO:0007249	Process	Canonical NF-kappaB signal transduction	IDA	26839314
GO:0007628	Process	Adult walking behavior	IEA
GO:0008277	Process	Regulation of G protein-coupled receptor signaling pathway	IEA
GO:0009968	Process	Negative regulation of signal transduction	IEA
GO:0010613	Process	Positive regulation of cardiac muscle hypertrophy	IC	10644702
GO:0010613	Process	Positive regulation of cardiac muscle hypertrophy	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016567	Process	Protein ubiquitination	IMP	15878855
GO:0019233	Process	Sensory perception of pain	IBA
GO:0019899	Function	Enzyme binding	IEA
GO:0019899	Function	Enzyme binding	IPI	23382074
GO:0030139	Component	Endocytic vesicle	IDA	23341447
GO:0030666	Component	Endocytic vesicle membrane	TAS
GO:0030674	Function	Protein-macromolecule adaptor activity	IDA	22810587
GO:0031397	Process	Negative regulation of protein ubiquitination	IDA	16378096
GO:0031397	Process	Negative regulation of protein ubiquitination	IEA
GO:0031410	Component	Cytoplasmic vesicle	IDA	12958365, 15611106
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031623	Process	Receptor internalization	IDA	12958365
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	15878855
GO:0031701	Function	Angiotensin receptor binding	IBA
GO:0031701	Function	Angiotensin receptor binding	IEA
GO:0031701	Function	Angiotensin receptor binding	IPI	15611106
GO:0031748	Function	D1 dopamine receptor binding	IBA
GO:0031748	Function	D1 dopamine receptor binding	IPI	33571431
GO:0032088	Process	Negative regulation of NF-kappaB transcription factor activity	IDA	15125834, 16378096
GO:0032226	Process	Positive regulation of synaptic transmission, dopaminergic	IEA
GO:0032691	Process	Negative regulation of interleukin-1 beta production	IEA
GO:0032695	Process	Negative regulation of interleukin-12 production	IEA
GO:0032715	Process	Negative regulation of interleukin-6 production	IEA
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IEA
GO:0034122	Process	Negative regulation of toll-like receptor signaling pathway	IEA
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IDA	26839314
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IDA	26839314
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IEA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IMP	15878855
GO:0043422	Function	Protein kinase B binding	IEA
GO:0045953	Process	Negative regulation of natural killer cell mediated cytotoxicity	IMP	18604210
GO:0050804	Process	Modulation of chemical synaptic transmission	IBA
GO:0050804	Process	Modulation of chemical synaptic transmission	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0051898	Process	Negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	NAS	21711983
GO:0060079	Process	Excitatory postsynaptic potential	NAS	21711983
GO:0060090	Function	Molecular adaptor activity	IDA	22810587, 26839314, 35817871, 37209686, 38175886
GO:0060326	Process	Cell chemotaxis	IMP	15635042
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IBA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	10644702
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IMP	12582207
GO:0098794	Component	Postsynapse	IEA
GO:0098926	Process	Postsynaptic signal transduction	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0160213	Process	Beta-arrestin-dependent dopamine receptor signaling pathway	NAS	21711983
GO:1902533	Process	Positive regulation of intracellular signal transduction	IEA
GO:2000727	Process	Positive regulation of cardiac muscle cell differentiation	IEA

Other IDs

• MIM: 107941
• HGNC: 712
• e!Ensembl: ENSG00000141480

Protein

• UniProt ID: P32121
• Protein name: Beta-arrestin-2 (Arrestin beta-2) (Non-visual arrestin-3)
• Protein function: Functions in regulating agonist-mediated G-protein coupled receptor (GPCR) signaling by mediating both receptor desensitization and resensitization processes. During homologous desensitization, beta-arrestins bind to the GPRK-phosphorylated rece
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00339	Arrestin_N	19 → 175	Arrestin (or S-antigen), N-terminal domain	Domain
  PF02752	Arrestin_C	194 → 349	Arrestin (or S-antigen), C-terminal domain	Domain

• Sequence:

  MGEKPGTRVFKKSSPNCKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKVFVTLTC
  AFRYGREDLDVLGLSFRKDLFIATYQAFPPVPNPPRPPTRLQDRLLRKLGQHAHPFFFTI
  PQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSLEEKSHKRNSVRLVIRKVQFAPEKPG
  PQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPLNVNVHVTNNSTKTVKKIKVSVRQYA
  DICLFSTAQYKCPVAQLEQDDQVSPSSTFCKVYTITPLLSDNREKRGLALDGKLKHEDTN
  LASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHIPLPRPQS
  AAPETDVPVDTNLIEFDTNYATDDDIVFEDFARLRLKGMKDDDYDDQLC

• Sequence length: 409

Pathways

KEGG:

MAPK signaling pathway
Chemokine signaling pathway
Endocytosis
Hedgehog signaling pathway
Dopaminergic synapse
Olfactory transduction
Relaxin signaling pathway
Parathyroid hormone synthesis, secretion and action
GnRH secretion
Morphine addiction
Chemical carcinogenesis - receptor activation

Reactome:

G alpha (s) signalling events
Thrombin signalling through proteinase activated receptors (PARs)
WNT5A-dependent internalization of FZD4
Activation of SMO
MAP2K and MAPK activation
Ub-specific processing proteases
Signaling by moderate kinase activity BRAF mutants
Signaling by high-kinase activity BRAF mutants
Signaling by BRAF and RAF fusions
Paradoxical activation of RAF signaling by kinase inactive BRAF
Cargo recognition for clathrin-mediated endocytosis
Clathrin-mediated endocytosis
Signaling downstream of RAS mutants

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AMPHETAMINE OR RELATED ACTING SYMPATHOMIMETIC ABUSE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMPHETAMINE-RELATED DISORDERS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BEHCET'S SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute pancreatitis	Pancreatitis	BEFREE	30144357		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	21390188		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	30078843		★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	30283336		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	28611418	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	24635845		★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	29196344		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	21855149		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	29361236		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	29272019, 30541881		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	29272019	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	18191226		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	19609003, 25973019		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	22961449	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	37100034	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	29636059, 30718498, 30793522		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	24912856		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	25354317		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	31515529, 8293560		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29559707		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	29625512		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	28980286		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	28980286	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	25354317		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	21644508, 22523395		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	PSYGENET_DG	18191226		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes	Diabetes	BEFREE	28888936		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28888936		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	19122674, 28888936		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	27054338		★☆☆☆☆ Found in Text Mining only
Dyskinetic syndrome	Dyskinetic Syndrome	LHGDN	19049562		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	31469177		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	31675995		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	30283336		★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Tendon Sheath	Giant cell tumor of tendon sheath	Pubtator	33994368	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	31515529, 8293560		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	37092838, 37100034	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	27054338		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	25354317		★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	22315403		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	30794438		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	30212930	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	28642577		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26077142, 30283336		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	24912856		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Diseases	Lung disease	Pubtator	33649538	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	37443143, 38066059	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	17890288		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19609003, 25973019		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	31675995		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	14633711, 21390188, 22009763, 22144662		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	25973019, 30787175		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	PSYGENET_DG	18191226		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	18191226		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	31270323		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	17363685		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	PSYGENET_DG	17363685		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	24736311		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	29625512		★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	31515529		★☆☆☆☆ Found in Text Mining only
Necrotizing Enterocolitis	Necrotizing Enterocolitis	BEFREE	31612867		★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	31612867		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11559553, 17890288, 22315403, 25973019, 29559707, 30787175		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	20643133, 28646018		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	31270323		★☆☆☆☆ Found in Text Mining only
Phobic anxiety disorder	Phobic Anxiety Disorder	BEFREE	28167453		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	28167453		★☆☆☆☆ Found in Text Mining only
Prolactinoma	Prolactinoma	BEFREE	24169548		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	14633711, 21390188, 22009763, 22144662		★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	21390188, 22144662		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	15065085		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	15229631, 36284990	Associate	★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29559707		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	28274926		★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	30681766		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	30988705		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	17233643, 19049562		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	28525390		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	BEFREE	31106661		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	30078843		★☆☆☆☆ Found in Text Mining only
Thyroid Nodule	Thyroid Nodule	BEFREE	11119705		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	25354317		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	33829064	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	34873055	Associate	★☆☆☆☆ Found in Text Mining only
WHIM syndrome	Whim syndrome	Pubtator	18436740	Associate	★☆☆☆☆ Found in Text Mining only