Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	4085
Gene name	Mitotic arrest deficient 2 like 1
Gene symbol	MAD2L1
Synonyms (NCBI Gene)	HSMAD2MAD2
Chromosome	4
Chromosome location	4q27
Summary	MAD2L1 is a component of the mitotic spindle assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate. MAD2L1 is related to the MAD2L2 gene located on chromosome 1. A MAD2 pseudogene has b

Show/Hide all (83)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004853	hsa-miR-192-5p	Luciferase reporter assayqRT-PCRWestern blot	19074876
MIRT023679	hsa-miR-1-3p	Proteomics;Microarray	18668037
MIRT024623	hsa-miR-215-5p	Microarray	19074876
MIRT004853	hsa-miR-192-5p	Reporter assay;Western blot;Microarray;Other	19074876
MIRT048838	hsa-miR-93-5p	CLASH	23622248
MIRT054748	hsa-miR-28-5p	Luciferase reporter assayQRTPCRWestern blot	24843176
MIRT536209	hsa-miR-6507-3p	PAR-CLIP	22012620
MIRT536208	hsa-miR-4738-3p	PAR-CLIP	22012620
MIRT536207	hsa-miR-4261	PAR-CLIP	22012620
MIRT536206	hsa-miR-3671	PAR-CLIP	22012620
MIRT536205	hsa-miR-1297	PAR-CLIP	22012620
MIRT536204	hsa-miR-26a-5p	PAR-CLIP	22012620
MIRT536203	hsa-miR-26b-5p	PAR-CLIP	22012620
MIRT536202	hsa-miR-4465	PAR-CLIP	22012620
MIRT536201	hsa-miR-376a-3p	PAR-CLIP	22012620
MIRT536200	hsa-miR-376b-3p	PAR-CLIP	22012620
MIRT536199	hsa-miR-3977	PAR-CLIP	22012620
MIRT536198	hsa-miR-3978	PAR-CLIP	22012620
MIRT736537	hsa-miR-139-5p	Luciferase reporter assayWestern blottingqRT-PCR	33204298
MIRT536209	hsa-miR-6507-3p	PAR-CLIP	22012620
MIRT536208	hsa-miR-4738-3p	PAR-CLIP	22012620
MIRT536207	hsa-miR-4261	PAR-CLIP	22012620
MIRT536206	hsa-miR-3671	PAR-CLIP	22012620
MIRT536205	hsa-miR-1297	PAR-CLIP	22012620
MIRT536204	hsa-miR-26a-5p	PAR-CLIP	22012620
MIRT536203	hsa-miR-26b-5p	PAR-CLIP	22012620
MIRT536202	hsa-miR-4465	PAR-CLIP	22012620
MIRT536201	hsa-miR-376a-3p	PAR-CLIP	22012620
MIRT536200	hsa-miR-376b-3p	PAR-CLIP	22012620
MIRT536199	hsa-miR-3977	PAR-CLIP	22012620
MIRT536198	hsa-miR-3978	PAR-CLIP	22012620
MIRT1125045	hsa-miR-101	CLIP-seq
MIRT1125046	hsa-miR-1238	CLIP-seq
MIRT1125047	hsa-miR-1284	CLIP-seq
MIRT1125048	hsa-miR-203	CLIP-seq
MIRT1125049	hsa-miR-26a	CLIP-seq
MIRT1125050	hsa-miR-26b	CLIP-seq
MIRT1125051	hsa-miR-3120-3p	CLIP-seq
MIRT1125052	hsa-miR-3139	CLIP-seq
MIRT1125053	hsa-miR-329	CLIP-seq
MIRT1125054	hsa-miR-362-3p	CLIP-seq
MIRT1125055	hsa-miR-3646	CLIP-seq
MIRT1125056	hsa-miR-3658	CLIP-seq
MIRT1125057	hsa-miR-3686	CLIP-seq
MIRT1125058	hsa-miR-376a	CLIP-seq
MIRT1125059	hsa-miR-376b	CLIP-seq
MIRT1125060	hsa-miR-3941	CLIP-seq
MIRT1125061	hsa-miR-3942-5p	CLIP-seq
MIRT1125062	hsa-miR-3974	CLIP-seq
MIRT1125063	hsa-miR-4289	CLIP-seq
MIRT1125064	hsa-miR-433	CLIP-seq
MIRT1125065	hsa-miR-4633-3p	CLIP-seq
MIRT1125066	hsa-miR-4698	CLIP-seq
MIRT1125067	hsa-miR-4703-5p	CLIP-seq
MIRT1125068	hsa-miR-4742-3p	CLIP-seq
MIRT1125069	hsa-miR-4760-3p	CLIP-seq
MIRT1125070	hsa-miR-4764-3p	CLIP-seq
MIRT1125071	hsa-miR-493	CLIP-seq
MIRT1125072	hsa-miR-495	CLIP-seq
MIRT1125073	hsa-miR-548aa	CLIP-seq
MIRT1125074	hsa-miR-603	CLIP-seq
MIRT1125075	hsa-miR-607	CLIP-seq
MIRT1125076	hsa-miR-708	CLIP-seq
MIRT1125077	hsa-miR-873	CLIP-seq
MIRT1125047	hsa-miR-1284	CLIP-seq
MIRT1125051	hsa-miR-3120-3p	CLIP-seq
MIRT1125057	hsa-miR-3686	CLIP-seq
MIRT1125068	hsa-miR-4742-3p	CLIP-seq
MIRT1125072	hsa-miR-495	CLIP-seq
MIRT2035291	hsa-miR-499-3p	CLIP-seq
MIRT2035292	hsa-miR-499a-3p	CLIP-seq
MIRT2035293	hsa-miR-582-5p	CLIP-seq
MIRT2035294	hsa-miR-587	CLIP-seq
MIRT2035295	hsa-miR-935	CLIP-seq
MIRT2265790	hsa-miR-3163	CLIP-seq
MIRT2265791	hsa-miR-340	CLIP-seq
MIRT2265792	hsa-miR-4436a	CLIP-seq
MIRT2265793	hsa-miR-4643	CLIP-seq
MIRT1125072	hsa-miR-495	CLIP-seq
MIRT2565090	hsa-miR-3613-3p	CLIP-seq
MIRT2565091	hsa-miR-548ac	CLIP-seq
MIRT2565092	hsa-miR-548d-3p	CLIP-seq
MIRT2565093	hsa-miR-548z	CLIP-seq

Show/Hide all (4)

Transcription factor	Regulation	Reference
BRCA1	Activation	15563594
ETV6	Repression	20190817
POU2F1	Activation	15563594
RUNX1	Repression	20190817

Show/Hide all (37)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000070	Process	Mitotic sister chromatid segregation	IEA
GO:0000132	Process	Establishment of mitotic spindle orientation	IMP	23509069
GO:0000775	Component	Chromosome, centromeric region	IEA
GO:0000776	Component	Kinetochore	IBA
GO:0000776	Component	Kinetochore	IDA	17363900, 19468067
GO:0000776	Component	Kinetochore	IDA	8824189, 19229290, 20133940
GO:0000776	Component	Kinetochore	IEA
GO:0000922	Component	Spindle pole	IEA
GO:0005515	Function	Protein binding	IPI	10200259, 10527948, 10700282, 12006501, 15182668, 15525512, 16189514, 16525508, 17443180, 17443186, 18022367, 18022368, 18318601, 18692475, 18794143, 18981471, 19010891, 19143472, 19273613, 19615732, 20133940, 20212161, 20360068, 20951947, 21041666, 21300909, 21407176, 21666598, 217
GO:0005634	Component	Nucleus	IDA	18981471, 19010891, 20870947
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	18981471
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0007094	Process	Mitotic spindle assembly checkpoint signaling	IBA
GO:0007094	Process	Mitotic spindle assembly checkpoint signaling	IDA	18981471
GO:0007094	Process	Mitotic spindle assembly checkpoint signaling	IEA
GO:0007094	Process	Mitotic spindle assembly checkpoint signaling	NAS	11535616
GO:0033597	Component	Mitotic checkpoint complex	IPI	27509861
GO:0042177	Process	Negative regulation of protein catabolic process	IDA	11459825
GO:0042802	Function	Identical protein binding	IPI	16525508, 18022367, 18318601, 21041666, 21772247
GO:0042803	Function	Protein homodimerization activity	IPI	18022367
GO:0044615	Component	Nuclear pore nuclear basket	IDA	18981471
GO:0045930	Process	Negative regulation of mitotic cell cycle	IMP	21274008
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	8824189, 20870947
GO:0051301	Process	Cell division	IEA
GO:0051660	Process	Establishment of centrosome localization	IMP	23509069
GO:0051783	Process	Regulation of nuclear division	IEA
GO:0072686	Component	Mitotic spindle	IDA	20133940
GO:0090267	Process	Positive regulation of mitotic cell cycle spindle assembly checkpoint	IDA	8824189, 22898774
GO:1901991	Process	Negative regulation of mitotic cell cycle phase transition	IEA
GO:1904667	Process	Negative regulation of ubiquitin protein ligase activity	IDA	11459825
GO:1990728	Component	Mitotic spindle assembly checkpoint MAD1-MAD2 complex	IEA
GO:1990728	Component	Mitotic spindle assembly checkpoint MAD1-MAD2 complex	IPI	12006501

MIM	HGNC	e!Ensembl
601467	6763	ENSG00000164109

Q13257

Protein name

Mitotic spindle assembly checkpoint protein MAD2A (HsMAD2) (Mitotic arrest deficient 2-like protein 1) (MAD2-like protein 1)

Protein function

Component of the spindle-assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate (PubMed:15024386, PubMed:29162720). In the closed conformation (C-MAD2) forms a heterotetrameric c

PDB

1DUJ , 1GO4 , 1KLQ , 1S2H , 2QYF , 2V64 , 2VFX , 3GMH , 5KHU , 5LCW , 6F0X , 6TLJ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02301	HORMA	16 → 196	HORMA domain	Domain

Sequence

MALQLSREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLE
LIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKS
QKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEE
VRLRSFTTTIHKVNSMVAYKIPVND

Sequence length

205

Interactions

View interactions

	KEGG		Reactome
	Cell cycle Oocyte meiosis Progesterone-mediated oocyte maturation Human T-cell leukemia virus 1 infection		Inhibition of the proteolytic activity of APC/C required for the onset of anaphase by mitotic spindle checkpoint components Inactivation of APC/C via direct inhibition of the APC/C complex Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal Cdc20:Phospho-APC/C mediated degradation of Cyclin A APC/C:Cdc20 mediated degradation of mitotic proteins APC-Cdc20 mediated degradation of Nek2A Separation of Sister Chromatids Resolution of Sister Chromatid Cohesion RHO GTPases Activate Formins Mitotic Prometaphase EML4 and NUDC in mitotic spindle formation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (11)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL SQUAMOUS CELL CARCINOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC OVARY SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (115)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	11572763, 15013707, 15457580, 18699967, 21376419		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	27835911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	32147961, 35185794, 38053725	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	27077767		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	11066082	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	17322345, 18699967, 20034488, 32057913	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	31173250, 32840301	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	19174606		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	15013707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	LHGDN	15013707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	11400114, 23995871, 27664031, 31396344		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11066082, 22759382, 24711138, 26287798, 26943585, 27292643		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	11066082, 17456764, 26287798, 33128008, 33499770, 35456460, 36930083	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	24843176	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	12970887, 15457580, 17322345, 30346937	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	20040022, 23995871		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	19664251, 29728556, 30341252, 31737652, 32623384, 34045512, 34337056, 34603487, 34696748, 35132379, 36317111	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	23995871, 27664031, 31396344		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	20516147, 21376419, 26980454, 28176922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	22069160	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	18791270	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	32795325, 35603384	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	22069160, 29465507, 30814209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	21378598	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	33725402	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chromosomal Instability	Chromosomal instability	Pubtator	17467818, 25411801, 26183163, 32066746	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	30601084		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	21377782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	15457580, 17457043, 26183163		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	12970887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	12970887	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	15457580, 17297307, 26183163, 28177905, 31173250, 31434359, 35774271, 36123948, 37286944, 37945594, 38637125	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	20032382		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	27424524		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	24491803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	26171692		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	20440596	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	30474315	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	19239430, 27077767		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	17498870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	33859719	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	22069160		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	19558549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	19558549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	19558549, 40598454	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	40598454	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	34655361	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	27315568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	18694480	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	22022424, 37468549	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	29408509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	24314588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	22759382	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperaldosteronism	Hyperaldosteronism	Pubtator	35185794	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	21472690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	32066746	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	25754611		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liposarcoma, Myxoid	liposarcoma	BEFREE	18477210		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	11400114, 17934339, 18715617, 25753876, 28238542, 28609841		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	15591789, 18715617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	19664251	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	11201745, 22992948		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	15070740, 32831194	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	12970887, 15457580	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	30346937	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	30601084		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11066082, 11390010, 22759382, 24711138, 26287798, 26943585, 27292643		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	18691855, 19558549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	20516147, 21376419, 26980454, 28176922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	25754611		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	11572763, 16112690, 20440596, 25483095, 30448220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	23995871, 27664031, 31396344		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11066082, 11400114, 11572763, 16760651, 17044027, 17222786, 18691855, 18715617, 19935801, 20034488, 20440596, 21376419, 21901524, 22759382, 22992948 View all (8 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	11066082		★★★★★ ★☆☆☆☆ Found in Text Mining only
Marginal Zone B-Cell Lymphoma	B-Cell Lymphoma	BEFREE	19174606		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	24669013, 33800494	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic Dermatofibrosarcoma Protuberans	Metastatic Dermatofibrosarcoma Protuberans	BEFREE	18477210		★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	20643875		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucositis	Mucositis	Pubtator	21378598	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	27010134	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	25637637, 29220700		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	11133821, 15735033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	35509856	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10543255, 11400114, 15254432, 15306814, 15457580, 16402339, 17189715, 17259655, 17498870, 18477210, 18715617, 18791270, 20032382, 20440596, 21665145 View all (9 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	21046120		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	21376419, 25256346, 27697601, 30346937, 31805030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	21901524, 22992948, 26096802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	29620143, 33153400	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	22069160, 26943585, 32180586, 33370338	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Serous Adenocarcinoma	Ovarian serous adenocarcinoma	BEFREE	22797604		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	CTD_human_DG	21411543		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	35305591	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	36497125	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	15306814, 28176922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	18477210		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	LHGDN	18477210		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sclerocystic Ovaries	Sclerocystic Ovaries	CTD_human_DG	21411543		★★★★★ ★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	17467818	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	30346937, 31516585		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	30346937, 33186389	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	25503128		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	18691855		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	CTD_human_DG	18691855		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	16112690, 20440596, 25483095, 30448220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	11572763, 15484292, 20440596, 25483095, 33446695, 34126961	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	16112690, 16214181, 16714000		★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular germ cell tumor	Pubtator	27315568	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	30213925, 31183379	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	18383837		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	31089242	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	17322345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	40598454	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	23995871		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	31337953	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

MAD2L1 (mitotic arrest deficient 2 like 1)