Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	4070
Gene name	Tumor associated calcium signal transducer 2
Gene symbol	TACSTD2
Synonyms (NCBI Gene)	EGP-1EGP1GA733-1GA7331GP50M1S1TROP2
Chromosome	1
Chromosome location	1p32.1
Summary	This intronless gene encodes a carcinoma-associated antigen. This antigen is a cell surface receptor that transduces calcium signals. Mutations of this gene have been associated with gelatinous drop-like corneal dystrophy.[provided by RefSeq, Dec 2009]

Show/Hide all (7)

SNP ID	Visualize variation	Clinical significance	Consequence
rs80358223	G>A	Pathogenic	Coding sequence variant, stop gained
rs80358224	G>A	Pathogenic	Coding sequence variant, stop gained
rs80358225	G>T	Pathogenic	Coding sequence variant, stop gained
rs80358226	A>C,G,T	Pathogenic	Initiator codon variant, missense variant
rs80358227	A>T	Pathogenic	Missense variant, coding sequence variant
rs80358228	A>G	Pathogenic	Missense variant, coding sequence variant
rs1569579635	T>-	Pathogenic	Frameshift variant, coding sequence variant

143

Show/Hide all (143)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001496	hsa-miR-155-5p	pSILAC	18668040
MIRT017057	hsa-miR-335-5p	Microarray	18185580
MIRT001496	hsa-miR-155-5p	Proteomics;Other	18668040
MIRT438121	hsa-miR-125b-1-3p	Luciferase reporter assay	23416980
MIRT438121	hsa-miR-125b-1-3p	Luciferase reporter assay	23416980
MIRT438121	hsa-miR-125b-1-3p	Luciferase reporter assay	23416980
MIRT438121	hsa-miR-125b-1-3p	Luciferase reporter assay	23416980
MIRT1408563	hsa-miR-1180	CLIP-seq
MIRT1408564	hsa-miR-151-3p	CLIP-seq
MIRT1408565	hsa-miR-193a-5p	CLIP-seq
MIRT1408566	hsa-miR-205	CLIP-seq
MIRT1408567	hsa-miR-2115	CLIP-seq
MIRT1408568	hsa-miR-2467-5p	CLIP-seq
MIRT1408569	hsa-miR-299-3p	CLIP-seq
MIRT1408570	hsa-miR-3074-3p	CLIP-seq
MIRT1408571	hsa-miR-3121-3p	CLIP-seq
MIRT1408572	hsa-miR-3121-5p	CLIP-seq
MIRT1408573	hsa-miR-3124-3p	CLIP-seq
MIRT1408574	hsa-miR-3185	CLIP-seq
MIRT1408575	hsa-miR-3188	CLIP-seq
MIRT1408576	hsa-miR-3192	CLIP-seq
MIRT1408577	hsa-miR-3195	CLIP-seq
MIRT1408578	hsa-miR-323-3p	CLIP-seq
MIRT1408579	hsa-miR-323b-5p	CLIP-seq
MIRT1408580	hsa-miR-331-3p	CLIP-seq
MIRT1408581	hsa-miR-34a	CLIP-seq
MIRT1408582	hsa-miR-34c-5p	CLIP-seq
MIRT1408583	hsa-miR-3614-5p	CLIP-seq
MIRT1408584	hsa-miR-3617	CLIP-seq
MIRT1408585	hsa-miR-3646	CLIP-seq
MIRT1408586	hsa-miR-3680	CLIP-seq
MIRT1408587	hsa-miR-374c	CLIP-seq
MIRT1408588	hsa-miR-376c	CLIP-seq
MIRT1408589	hsa-miR-3909	CLIP-seq
MIRT1408590	hsa-miR-3941	CLIP-seq
MIRT1408591	hsa-miR-3975	CLIP-seq
MIRT1408592	hsa-miR-4269	CLIP-seq
MIRT1408593	hsa-miR-4279	CLIP-seq
MIRT1408594	hsa-miR-4314	CLIP-seq
MIRT1408595	hsa-miR-4438	CLIP-seq
MIRT1408596	hsa-miR-4463	CLIP-seq
MIRT1408597	hsa-miR-4491	CLIP-seq
MIRT1408598	hsa-miR-4497	CLIP-seq
MIRT1408599	hsa-miR-4499	CLIP-seq
MIRT1408600	hsa-miR-449a	CLIP-seq
MIRT1408601	hsa-miR-449b	CLIP-seq
MIRT1408602	hsa-miR-4504	CLIP-seq
MIRT1408603	hsa-miR-4514	CLIP-seq
MIRT1408604	hsa-miR-4643	CLIP-seq
MIRT1408605	hsa-miR-4646-5p	CLIP-seq
MIRT1408606	hsa-miR-4657	CLIP-seq
MIRT1408607	hsa-miR-466	CLIP-seq
MIRT1408608	hsa-miR-4664-3p	CLIP-seq
MIRT1408609	hsa-miR-4672	CLIP-seq
MIRT1408610	hsa-miR-4682	CLIP-seq
MIRT1408611	hsa-miR-4692	CLIP-seq
MIRT1408612	hsa-miR-4742-5p	CLIP-seq
MIRT1408613	hsa-miR-4747-3p	CLIP-seq
MIRT1408614	hsa-miR-4789-3p	CLIP-seq
MIRT1408615	hsa-miR-485-3p	CLIP-seq
MIRT1408616	hsa-miR-485-5p	CLIP-seq
MIRT1408617	hsa-miR-488	CLIP-seq
MIRT1408618	hsa-miR-494	CLIP-seq
MIRT1408619	hsa-miR-495	CLIP-seq
MIRT1408620	hsa-miR-516a-3p	CLIP-seq
MIRT1408621	hsa-miR-539	CLIP-seq
MIRT1408622	hsa-miR-641	CLIP-seq
MIRT1408623	hsa-miR-654-3p	CLIP-seq
MIRT1408624	hsa-miR-655	CLIP-seq
MIRT1408625	hsa-miR-873	CLIP-seq
MIRT1408626	hsa-miR-942	CLIP-seq
MIRT2122557	hsa-miR-188-5p	CLIP-seq
MIRT2122558	hsa-miR-1913	CLIP-seq
MIRT1408565	hsa-miR-193a-5p	CLIP-seq
MIRT1408566	hsa-miR-205	CLIP-seq
MIRT1408567	hsa-miR-2115	CLIP-seq
MIRT2122559	hsa-miR-300	CLIP-seq
MIRT2122560	hsa-miR-3074-5p	CLIP-seq
MIRT2122561	hsa-miR-3120-3p	CLIP-seq
MIRT2122562	hsa-miR-3133	CLIP-seq
MIRT2122563	hsa-miR-3189-5p	CLIP-seq
MIRT1408576	hsa-miR-3192	CLIP-seq
MIRT1408577	hsa-miR-3195	CLIP-seq
MIRT1408579	hsa-miR-323b-5p	CLIP-seq
MIRT2122564	hsa-miR-324-3p	CLIP-seq
MIRT2122565	hsa-miR-3613-3p	CLIP-seq
MIRT1408583	hsa-miR-3614-5p	CLIP-seq
MIRT2122566	hsa-miR-3667-3p	CLIP-seq
MIRT2122567	hsa-miR-3671	CLIP-seq
MIRT1408586	hsa-miR-3680	CLIP-seq
MIRT2122568	hsa-miR-381	CLIP-seq
MIRT1408590	hsa-miR-3941	CLIP-seq
MIRT1408593	hsa-miR-4279	CLIP-seq
MIRT1408594	hsa-miR-4314	CLIP-seq
MIRT2122569	hsa-miR-4420	CLIP-seq
MIRT2122570	hsa-miR-4532	CLIP-seq
MIRT1408604	hsa-miR-4643	CLIP-seq
MIRT1408605	hsa-miR-4646-5p	CLIP-seq
MIRT1408607	hsa-miR-466	CLIP-seq
MIRT1408609	hsa-miR-4672	CLIP-seq
MIRT2122571	hsa-miR-4717-5p	CLIP-seq
MIRT2122572	hsa-miR-4758-3p	CLIP-seq
MIRT1408614	hsa-miR-4789-3p	CLIP-seq
MIRT1408615	hsa-miR-485-3p	CLIP-seq
MIRT1408619	hsa-miR-495	CLIP-seq
MIRT1408620	hsa-miR-516a-3p	CLIP-seq
MIRT2122573	hsa-miR-520d-5p	CLIP-seq
MIRT2122574	hsa-miR-524-5p	CLIP-seq
MIRT1408625	hsa-miR-873	CLIP-seq
MIRT1408626	hsa-miR-942	CLIP-seq
MIRT1408569	hsa-miR-299-3p	CLIP-seq
MIRT2122559	hsa-miR-300	CLIP-seq
MIRT2122561	hsa-miR-3120-3p	CLIP-seq
MIRT1408587	hsa-miR-374c	CLIP-seq
MIRT2122568	hsa-miR-381	CLIP-seq
MIRT1408597	hsa-miR-4491	CLIP-seq
MIRT1408606	hsa-miR-4657	CLIP-seq
MIRT1408610	hsa-miR-4682	CLIP-seq
MIRT2344971	hsa-miR-518a-5p	CLIP-seq
MIRT2344972	hsa-miR-527	CLIP-seq
MIRT1408624	hsa-miR-655	CLIP-seq
MIRT2344973	hsa-miR-935	CLIP-seq
MIRT2395495	hsa-miR-1246	CLIP-seq
MIRT1408570	hsa-miR-3074-3p	CLIP-seq
MIRT1408581	hsa-miR-34a	CLIP-seq
MIRT1408582	hsa-miR-34c-5p	CLIP-seq
MIRT2395496	hsa-miR-3614-3p	CLIP-seq
MIRT1408600	hsa-miR-449a	CLIP-seq
MIRT1408601	hsa-miR-449b	CLIP-seq
MIRT2395497	hsa-miR-4503	CLIP-seq
MIRT2395498	hsa-miR-4729	CLIP-seq
MIRT2395499	hsa-miR-513b	CLIP-seq
MIRT1408573	hsa-miR-3124-3p	CLIP-seq
MIRT1408602	hsa-miR-4504	CLIP-seq
MIRT1408569	hsa-miR-299-3p	CLIP-seq
MIRT1408573	hsa-miR-3124-3p	CLIP-seq
MIRT1408587	hsa-miR-374c	CLIP-seq
MIRT1408595	hsa-miR-4438	CLIP-seq
MIRT1408597	hsa-miR-4491	CLIP-seq
MIRT1408602	hsa-miR-4504	CLIP-seq
MIRT1408606	hsa-miR-4657	CLIP-seq
MIRT1408618	hsa-miR-494	CLIP-seq
MIRT1408624	hsa-miR-655	CLIP-seq

Show/Hide all (32)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	15607035, 32296183
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005829	Component	Cytosol	TAS	10192395
GO:0005886	Component	Plasma membrane	IEA
GO:0007601	Process	Visual perception	IEA
GO:0007601	Process	Visual perception	TAS	10192395
GO:0009925	Component	Basal plasma membrane	IEA
GO:0009925	Component	Basal plasma membrane	ISS
GO:0010633	Process	Negative regulation of epithelial cell migration	IEA
GO:0010633	Process	Negative regulation of epithelial cell migration	ISS
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	8382772
GO:0016328	Component	Lateral plasma membrane	IEA
GO:0016328	Component	Lateral plasma membrane	ISS
GO:0050678	Process	Regulation of epithelial cell proliferation	IEA
GO:0051497	Process	Negative regulation of stress fiber assembly	IEA
GO:0051497	Process	Negative regulation of stress fiber assembly	ISS
GO:0060675	Process	Ureteric bud morphogenesis	IEA
GO:0070062	Component	Extracellular exosome	HDA	19199708
GO:0090191	Process	Negative regulation of branching involved in ureteric bud morphogenesis	IEA
GO:0090191	Process	Negative regulation of branching involved in ureteric bud morphogenesis	ISS
GO:1900025	Process	Negative regulation of substrate adhesion-dependent cell spreading	IEA
GO:1900025	Process	Negative regulation of substrate adhesion-dependent cell spreading	ISS
GO:1900028	Process	Negative regulation of ruffle assembly	IEA
GO:1900028	Process	Negative regulation of ruffle assembly	ISS
GO:2000146	Process	Negative regulation of cell motility	IEA
GO:2000146	Process	Negative regulation of cell motility	ISS
GO:2000738	Process	Positive regulation of stem cell differentiation	IBA
GO:2000738	Process	Positive regulation of stem cell differentiation	IEA

MIM	HGNC	e!Ensembl
137290	11530	ENSG00000184292

P09758

Protein name

Tumor-associated calcium signal transducer 2 (Cell surface glycoprotein Trop-2) (Membrane component chromosome 1 surface marker 1) (Pancreatic carcinoma marker protein GA733-1)

Protein function

May function as a growth factor receptor.

PDB

2MAE , 2MVK , 2MVL , 7E5M , 7E5N , 7PEE

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00086	Thyroglobulin_1	73 → 145	Thyroglobulin type-1 repeat	Domain

Tissue specificity

TISSUE SPECIFICITY: Placenta, pancreatic carcinoma cell lines.

Sequence

MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGS
GMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCN
QTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLF
RERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRG
GLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAVIVVVVVALVAGMAVLVITNR
RKSGKYKKVEIKELGELRKEPSL

Sequence length

323

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Gelatinous droplike corneal dystrophy	Pathogenic; Likely pathogenic	rs780819073, rs80358223, rs80358224, rs80358225, rs1569579635, rs80358226, rs80358227, rs2523947665, rs80358228, rs2523948090	RCV002460351 RCV000017566 RCV000017567 RCV000017568 RCV000017569 View all (5 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (10)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AORTIC STENOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AORTIC VALVE CALCIFICATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORNEAL DYSTROPHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Corneal Dystrophy, Dominant/Recessive	Uncertain significance; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORNEAL DYSTROPHY, GELATINOUS DROP-LIKE	—	CTD, HPO CTD, HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORNEAL DYSTROPHY, LATTICE TYPE 3	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEREDITARY CORNEAL DYSTROPHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESTLESS LEGS SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TACSTD2-related disorder	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (157)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	16232198, 20473768, 26015409, 28404926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	16232198		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	16232198		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	LHGDN	17653040		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	26481593		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asymmetric Septal Hypertrophy	Septal Hypertrophy	BEFREE	29095436		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	28938585, 29901071		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	32283567	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	22053771, 23610368, 29901160, 30002602		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23610368, 30268765, 35477165, 35882754, 36302269, 37517589, 37675806, 39837304, 40579360	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchioloalveolar Adenocarcinoma	Lung adenocarcinoma	BEFREE	16232198		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	22482828, 28709407	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	19683559, 20473768, 20858281, 22378065, 23397225, 26862947, 29276405, 31594569, 8016075		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	23416980, 31969666	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	24651436	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	21892093	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	11768609, 29538454, 30678511, 33882870	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	36577919	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	28938585, 29901071		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	25779928, 26600538		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	24025415, 28404926, 31594569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	27127000	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	36878461	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	33882870, 33901032, 35477165	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	33901032	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	22482828, 32854652, 37067548, 39837304	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	24651436	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	35477165	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	BEFREE	21892093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Neuroendocrine	Carcinoma	BEFREE	30268765		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	20060709, 27127000, 28962108		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinosarcoma	BEFREE	22075385		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinoma	Pubtator	22075385	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	23031786		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	21889762, 24086649, 24816726, 25102337, 30429055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	21889762, 24086649, 24816726, 25102337, 30429055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	26626643, 31674732		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	33882870	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	23533570	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	6204750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	27887617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	29467899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	12118101		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	18281513		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	23055188	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	11768609, 16707602, 20473941, 20682974, 26494939, 26600538		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	11768609	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	16707602		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	18084248, 20473941, 23055188, 26494939, 26600538, 35477165, 36759721, 38063988, 38302503, 39177576	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	26626643		★★★★★ ★☆☆☆☆ Found in Text Mining only
Corneal dystrophy	Corneal Dystrophy	BEFREE	12107443		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Corneal dystrophy	Corneal Dystrophy	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Corneal dystrophy, Lattice type 3	Corneal Dystrophy	GENOMICS_ENGLAND_DG	10192395		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Corneal dystrophy, Lattice type 3	Corneal Dystrophy	BEFREE	11004271, 11687514, 12107443, 12614764, 15183793, 15254496, 15295654, 15652848, 17167402, 17653040, 17721311, 17768381, 17898270, 19693293, 20454699 View all (7 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Corneal dystrophy, Lattice type 3	Corneal Dystrophy	ORPHANET_DG	20454699		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Corneal dystrophy, Lattice type 3	Corneal Dystrophy	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Corneal dystrophy, Lattice type 3	Corneal Dystrophy	CLINVAR_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Craniopharyngioma	Craniopharyngioma	Pubtator	37870091	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ECTRODACTYLY, ECTODERMAL DYSPLASIA, AND CLEFT LIP/PALATE SYNDROME 1	Ectrodactyly	BEFREE	21892093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial hyperplasia	Pubtator	16232198	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	CTD_human_DG	20864642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	CTD_human_DG	20864642		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epithelial ovarian cancer	Ovarian cancer	BEFREE	20060709, 27127000		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Amyloid Polyneuropathy, Type V	Amyloid Polyneuropathy	BEFREE	10844062		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Alcoholic	Fatty liver, alcoholic	Pubtator	29095436	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Follicular adenoma	Adenoma	BEFREE	29951933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	28423362		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	25135430	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gelatinous drop-like corneal dystrophy	Gelatinous Droplike Corneal Dystrophy	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	30431125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	30431125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	23397225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	15254496		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	23416980, 25779928		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	23416980	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	30008230		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	29538454	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	31146656	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	30268765	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	38221567	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	23031786		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	19554511		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	25779928	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	26600538	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	22987366, 25779928		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	24764155		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	11768609, 25247452, 29538454, 30678511		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	28404926	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	18813308, 24086649, 25135430, 26716416, 28709407, 30098828	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26600538, 26617817, 28256068	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	23397225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	23416980, 25779928		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	22053771, 23610368, 27022065, 29901160, 30002602		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	28423362		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	26600538		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	24025415, 28404926, 31594569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	24764155		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	28962108		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	31674732		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	20699414, 20699415, 22378065, 23070813, 23674207, 23969936, 25252911, 26015409		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	26716416, 27207776, 28256068, 30632714		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	28709407, 30800635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	28938585, 29901071		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16707602, 18829570, 21889762, 22053771, 22349828, 22562244, 22987366, 23070813, 23397225, 23674207, 24086649, 24651436, 25164548, 25701778, 26481593 View all (9 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	21889762, 24086649, 24816726, 25102337, 30429055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	18281513, 29467899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	30002602		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medullary carcinoma	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	26481593		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	26481593		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	30008230		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	26617817	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10192395, 15958618, 16707602, 18281513, 18829570, 19683559, 20473768, 20858281, 21889762, 21892093, 22349828, 22562244, 23397225, 24025415, 24086649 View all (25 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28345466, 28548889, 31594569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Atrophy, Hereditary, Leber	Hereditary Leber Optic Atrophy	BEFREE	29775755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteomalacia	Osteomalacia	Pubtator	32283567	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	29845216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian Diseases	BEFREE	21453957		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	22075385	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	28962108		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	21453957, 37418532	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	35477165	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	25252911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	31674732		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	18813308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	18813308, 36878461	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	40474193	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	25164548, 26481593, 26862947, 29951933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	25550831	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate cancer familial	Prostate cancer	Pubtator	29095436	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	20699414, 20699415, 22378065, 23070813, 23674207, 23969936, 25252911, 26015409		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	20699414, 20699415		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	20699414, 26015409		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	20699414, 23450810, 33009488, 38177207, 40615466	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	22378065	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	27887617	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	35735421	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	33886073	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma Limited	Scleroderma	Pubtator	27887617	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	28679770		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	40064573	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	18084248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	24651436, 28404926, 31638186		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	18084248, 25779928, 30098828, 32854652, 35008509	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	25238142, 29305574		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	26716416, 28256068, 30632714		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26716416, 28256068, 31964857, 35477165, 38221567	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	26862947, 28547974, 38073379	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	35477165	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	28709407, 30800635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	26862947, 28709407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	26862947	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	28709407	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	28291390, 29055700, 30507322		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	34116144, 36153494, 38092228, 38422473, 39177576, 40474193	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	35008509	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	29901071, 35216942	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	21889762, 24086649, 24816726, 31969666	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

TACSTD2 (tumor associated calcium signal transducer 2)