Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	4069
Gene name	Lysozyme
Gene symbol	LYZ
Synonyms (NCBI Gene)	AMYLD5LYZF1LZM
Chromosome	12
Chromosome location	12q15
Summary	This gene encodes human lysozyme, whose natural substrate is the bacterial cell wall peptidoglycan (cleaving the beta[1-4]glycosidic linkages between N-acetylmuramic acid and N-acetylglucosamine). Lysozyme is one of the antimicrobial agents found in human

Show/Hide all (4)

SNP ID	Visualize variation	Clinical significance	Consequence
rs121913547	T>C	Pathogenic	Coding sequence variant, missense variant
rs121913549	T>A	Pathogenic	Coding sequence variant, missense variant
rs387906535	G>C	Pathogenic	Missense variant, coding sequence variant
rs387906536	T>A,C	Pathogenic	Missense variant, coding sequence variant

261

Show/Hide all (261)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030049	hsa-miR-26b-5p	Microarray	19088304
MIRT696225	hsa-miR-508-5p	HITS-CLIP	23313552
MIRT696224	hsa-miR-3613-3p	HITS-CLIP	23313552
MIRT696223	hsa-miR-6849-3p	HITS-CLIP	23313552
MIRT696222	hsa-miR-939-3p	HITS-CLIP	23313552
MIRT696221	hsa-miR-371b-5p	HITS-CLIP	23313552
MIRT696220	hsa-miR-373-5p	HITS-CLIP	23313552
MIRT696219	hsa-miR-616-5p	HITS-CLIP	23313552
MIRT696218	hsa-miR-371a-5p	HITS-CLIP	23313552
MIRT696217	hsa-miR-372-5p	HITS-CLIP	23313552
MIRT696216	hsa-miR-766-3p	HITS-CLIP	23313552
MIRT696215	hsa-miR-4486	HITS-CLIP	23313552
MIRT696214	hsa-miR-873-3p	HITS-CLIP	23313552
MIRT696213	hsa-miR-661	HITS-CLIP	23313552
MIRT696212	hsa-miR-1273a	HITS-CLIP	23313552
MIRT696211	hsa-miR-4649-5p	HITS-CLIP	23313552
MIRT696210	hsa-miR-6729-5p	HITS-CLIP	23313552
MIRT696209	hsa-miR-6512-3p	HITS-CLIP	23313552
MIRT696207	hsa-miR-6720-5p	HITS-CLIP	23313552
MIRT696208	hsa-miR-7703	HITS-CLIP	23313552
MIRT696206	hsa-miR-4668-5p	HITS-CLIP	23313552
MIRT696225	hsa-miR-508-5p	PAR-CLIP	27292025
MIRT696216	hsa-miR-766-3p	PAR-CLIP	27292025
MIRT696208	hsa-miR-7703	PAR-CLIP	27292025
MIRT696225	hsa-miR-508-5p	HITS-CLIP	23313552
MIRT696224	hsa-miR-3613-3p	HITS-CLIP	23313552
MIRT696223	hsa-miR-6849-3p	HITS-CLIP	23313552
MIRT696222	hsa-miR-939-3p	HITS-CLIP	23313552
MIRT696221	hsa-miR-371b-5p	HITS-CLIP	23313552
MIRT696220	hsa-miR-373-5p	HITS-CLIP	23313552
MIRT696219	hsa-miR-616-5p	HITS-CLIP	23313552
MIRT696218	hsa-miR-371a-5p	HITS-CLIP	23313552
MIRT696217	hsa-miR-372-5p	HITS-CLIP	23313552
MIRT696216	hsa-miR-766-3p	HITS-CLIP	23313552
MIRT696215	hsa-miR-4486	HITS-CLIP	23313552
MIRT696214	hsa-miR-873-3p	HITS-CLIP	23313552
MIRT696213	hsa-miR-661	HITS-CLIP	23313552
MIRT696212	hsa-miR-1273a	HITS-CLIP	23313552
MIRT696211	hsa-miR-4649-5p	HITS-CLIP	23313552
MIRT696210	hsa-miR-6729-5p	HITS-CLIP	23313552
MIRT696209	hsa-miR-6512-3p	HITS-CLIP	23313552
MIRT696207	hsa-miR-6720-5p	HITS-CLIP	23313552
MIRT696208	hsa-miR-7703	HITS-CLIP	23313552
MIRT696206	hsa-miR-4668-5p	HITS-CLIP	23313552
MIRT1124320	hsa-miR-1268	CLIP-seq
MIRT1124321	hsa-miR-1268b	CLIP-seq
MIRT1124322	hsa-miR-1273	CLIP-seq
MIRT1124323	hsa-miR-1293	CLIP-seq
MIRT1124324	hsa-miR-1827	CLIP-seq
MIRT1124325	hsa-miR-1908	CLIP-seq
MIRT1124326	hsa-miR-2682	CLIP-seq
MIRT1124327	hsa-miR-3122	CLIP-seq
MIRT1124328	hsa-miR-3165	CLIP-seq
MIRT1124329	hsa-miR-3689a-3p	CLIP-seq
MIRT1124330	hsa-miR-3689c	CLIP-seq
MIRT1124331	hsa-miR-3913-5p	CLIP-seq
MIRT1124332	hsa-miR-3929	CLIP-seq
MIRT1124333	hsa-miR-3974	CLIP-seq
MIRT1124334	hsa-miR-4269	CLIP-seq
MIRT1124335	hsa-miR-4419b	CLIP-seq
MIRT1124336	hsa-miR-4433	CLIP-seq
MIRT1124337	hsa-miR-4457	CLIP-seq
MIRT1124338	hsa-miR-4459	CLIP-seq
MIRT1124339	hsa-miR-4478	CLIP-seq
MIRT1124340	hsa-miR-4483	CLIP-seq
MIRT1124341	hsa-miR-449c	CLIP-seq
MIRT1124342	hsa-miR-4514	CLIP-seq
MIRT1124343	hsa-miR-4649-3p	CLIP-seq
MIRT1124344	hsa-miR-4683	CLIP-seq
MIRT1124345	hsa-miR-4692	CLIP-seq
MIRT1124346	hsa-miR-4722-5p	CLIP-seq
MIRT1124347	hsa-miR-4728-5p	CLIP-seq
MIRT1124348	hsa-miR-4742-5p	CLIP-seq
MIRT1124349	hsa-miR-4767	CLIP-seq
MIRT1124350	hsa-miR-4768-3p	CLIP-seq
MIRT1124351	hsa-miR-4786-5p	CLIP-seq
MIRT1124352	hsa-miR-4793-5p	CLIP-seq
MIRT1124353	hsa-miR-4794	CLIP-seq
MIRT1124354	hsa-miR-485-5p	CLIP-seq
MIRT1124355	hsa-miR-513b	CLIP-seq
MIRT1124356	hsa-miR-513c	CLIP-seq
MIRT1124357	hsa-miR-514b-5p	CLIP-seq
MIRT1124358	hsa-miR-548c-3p	CLIP-seq
MIRT1124359	hsa-miR-622	CLIP-seq
MIRT1124360	hsa-miR-624	CLIP-seq
MIRT1124361	hsa-miR-663	CLIP-seq
MIRT1124362	hsa-miR-766	CLIP-seq
MIRT1124363	hsa-miR-940	CLIP-seq
MIRT1124362	hsa-miR-766	CLIP-seq
MIRT1124322	hsa-miR-1273	CLIP-seq
MIRT1124324	hsa-miR-1827	CLIP-seq
MIRT1124332	hsa-miR-3929	CLIP-seq
MIRT1124335	hsa-miR-4419b	CLIP-seq
MIRT1124339	hsa-miR-4478	CLIP-seq
MIRT1124343	hsa-miR-4649-3p	CLIP-seq
MIRT1124344	hsa-miR-4683	CLIP-seq
MIRT1124346	hsa-miR-4722-5p	CLIP-seq
MIRT1124350	hsa-miR-4768-3p	CLIP-seq
MIRT1124354	hsa-miR-485-5p	CLIP-seq
MIRT1124362	hsa-miR-766	CLIP-seq
MIRT1124363	hsa-miR-940	CLIP-seq
MIRT1124322	hsa-miR-1273	CLIP-seq
MIRT1124323	hsa-miR-1293	CLIP-seq
MIRT1124324	hsa-miR-1827	CLIP-seq
MIRT1124327	hsa-miR-3122	CLIP-seq
MIRT1124328	hsa-miR-3165	CLIP-seq
MIRT1124329	hsa-miR-3689a-3p	CLIP-seq
MIRT1124330	hsa-miR-3689c	CLIP-seq
MIRT1124331	hsa-miR-3913-5p	CLIP-seq
MIRT1124332	hsa-miR-3929	CLIP-seq
MIRT1124333	hsa-miR-3974	CLIP-seq
MIRT2265556	hsa-miR-4330	CLIP-seq
MIRT1124335	hsa-miR-4419b	CLIP-seq
MIRT1124336	hsa-miR-4433	CLIP-seq
MIRT1124337	hsa-miR-4457	CLIP-seq
MIRT1124338	hsa-miR-4459	CLIP-seq
MIRT1124339	hsa-miR-4478	CLIP-seq
MIRT1124340	hsa-miR-4483	CLIP-seq
MIRT1124343	hsa-miR-4649-3p	CLIP-seq
MIRT1124344	hsa-miR-4683	CLIP-seq
MIRT1124346	hsa-miR-4722-5p	CLIP-seq
MIRT1124347	hsa-miR-4728-5p	CLIP-seq
MIRT1124350	hsa-miR-4768-3p	CLIP-seq
MIRT1124351	hsa-miR-4786-5p	CLIP-seq
MIRT1124352	hsa-miR-4793-5p	CLIP-seq
MIRT1124353	hsa-miR-4794	CLIP-seq
MIRT1124354	hsa-miR-485-5p	CLIP-seq
MIRT1124355	hsa-miR-513b	CLIP-seq
MIRT1124360	hsa-miR-624	CLIP-seq
MIRT1124362	hsa-miR-766	CLIP-seq
MIRT1124363	hsa-miR-940	CLIP-seq
MIRT2390426	hsa-miR-23a	CLIP-seq
MIRT2390427	hsa-miR-23b	CLIP-seq
MIRT2390428	hsa-miR-23c	CLIP-seq
MIRT1124333	hsa-miR-3974	CLIP-seq
MIRT1124336	hsa-miR-4433	CLIP-seq
MIRT1124337	hsa-miR-4457	CLIP-seq
MIRT1124338	hsa-miR-4459	CLIP-seq
MIRT1124344	hsa-miR-4683	CLIP-seq
MIRT1124350	hsa-miR-4768-3p	CLIP-seq
MIRT1124351	hsa-miR-4786-5p	CLIP-seq
MIRT1124352	hsa-miR-4793-5p	CLIP-seq
MIRT1124353	hsa-miR-4794	CLIP-seq
MIRT1124355	hsa-miR-513b	CLIP-seq
MIRT1124358	hsa-miR-548c-3p	CLIP-seq
MIRT1124360	hsa-miR-624	CLIP-seq
MIRT2390429	hsa-miR-758	CLIP-seq
MIRT2390430	hsa-miR-944	CLIP-seq
MIRT2453569	hsa-miR-10a	CLIP-seq
MIRT2453570	hsa-miR-10b	CLIP-seq
MIRT1124320	hsa-miR-1268	CLIP-seq
MIRT1124321	hsa-miR-1268b	CLIP-seq
MIRT1124323	hsa-miR-1293	CLIP-seq
MIRT1124325	hsa-miR-1908	CLIP-seq
MIRT1124327	hsa-miR-3122	CLIP-seq
MIRT1124328	hsa-miR-3165	CLIP-seq
MIRT2453571	hsa-miR-339-5p	CLIP-seq
MIRT1124329	hsa-miR-3689a-3p	CLIP-seq
MIRT1124330	hsa-miR-3689c	CLIP-seq
MIRT1124331	hsa-miR-3913-5p	CLIP-seq
MIRT1124333	hsa-miR-3974	CLIP-seq
MIRT2453572	hsa-miR-4421	CLIP-seq
MIRT1124336	hsa-miR-4433	CLIP-seq
MIRT1124337	hsa-miR-4457	CLIP-seq
MIRT1124338	hsa-miR-4459	CLIP-seq
MIRT1124340	hsa-miR-4483	CLIP-seq
MIRT2453573	hsa-miR-4684-5p	CLIP-seq
MIRT1124347	hsa-miR-4728-5p	CLIP-seq
MIRT1124349	hsa-miR-4767	CLIP-seq
MIRT1124350	hsa-miR-4768-3p	CLIP-seq
MIRT1124355	hsa-miR-513b	CLIP-seq
MIRT1124358	hsa-miR-548c-3p	CLIP-seq
MIRT2453574	hsa-miR-593	CLIP-seq
MIRT1124360	hsa-miR-624	CLIP-seq
MIRT1124361	hsa-miR-663	CLIP-seq
MIRT2453569	hsa-miR-10a	CLIP-seq
MIRT2453570	hsa-miR-10b	CLIP-seq
MIRT1124320	hsa-miR-1268	CLIP-seq
MIRT1124321	hsa-miR-1268b	CLIP-seq
MIRT1124325	hsa-miR-1908	CLIP-seq
MIRT2453571	hsa-miR-339-5p	CLIP-seq
MIRT2453572	hsa-miR-4421	CLIP-seq
MIRT2453573	hsa-miR-4684-5p	CLIP-seq
MIRT1124349	hsa-miR-4767	CLIP-seq
MIRT1124358	hsa-miR-548c-3p	CLIP-seq
MIRT2453574	hsa-miR-593	CLIP-seq
MIRT1124361	hsa-miR-663	CLIP-seq
MIRT2453569	hsa-miR-10a	CLIP-seq
MIRT2453570	hsa-miR-10b	CLIP-seq
MIRT1124320	hsa-miR-1268	CLIP-seq
MIRT1124321	hsa-miR-1268b	CLIP-seq
MIRT1124322	hsa-miR-1273	CLIP-seq
MIRT1124323	hsa-miR-1293	CLIP-seq
MIRT1124324	hsa-miR-1827	CLIP-seq
MIRT1124325	hsa-miR-1908	CLIP-seq
MIRT1124327	hsa-miR-3122	CLIP-seq
MIRT1124328	hsa-miR-3165	CLIP-seq
MIRT2453571	hsa-miR-339-5p	CLIP-seq
MIRT1124329	hsa-miR-3689a-3p	CLIP-seq
MIRT1124330	hsa-miR-3689c	CLIP-seq
MIRT2564912	hsa-miR-371-5p	CLIP-seq
MIRT1124331	hsa-miR-3913-5p	CLIP-seq
MIRT1124332	hsa-miR-3929	CLIP-seq
MIRT1124333	hsa-miR-3974	CLIP-seq
MIRT1124335	hsa-miR-4419b	CLIP-seq
MIRT2453572	hsa-miR-4421	CLIP-seq
MIRT1124336	hsa-miR-4433	CLIP-seq
MIRT1124337	hsa-miR-4457	CLIP-seq
MIRT1124338	hsa-miR-4459	CLIP-seq
MIRT1124339	hsa-miR-4478	CLIP-seq
MIRT1124340	hsa-miR-4483	CLIP-seq
MIRT1124344	hsa-miR-4683	CLIP-seq
MIRT2453573	hsa-miR-4684-5p	CLIP-seq
MIRT1124347	hsa-miR-4728-5p	CLIP-seq
MIRT1124349	hsa-miR-4767	CLIP-seq
MIRT1124350	hsa-miR-4768-3p	CLIP-seq
MIRT1124351	hsa-miR-4786-5p	CLIP-seq
MIRT1124352	hsa-miR-4793-5p	CLIP-seq
MIRT1124353	hsa-miR-4794	CLIP-seq
MIRT1124354	hsa-miR-485-5p	CLIP-seq
MIRT1124355	hsa-miR-513b	CLIP-seq
MIRT1124358	hsa-miR-548c-3p	CLIP-seq
MIRT2453574	hsa-miR-593	CLIP-seq
MIRT1124360	hsa-miR-624	CLIP-seq
MIRT1124361	hsa-miR-663	CLIP-seq
MIRT1124362	hsa-miR-766	CLIP-seq
MIRT1124363	hsa-miR-940	CLIP-seq
MIRT2453569	hsa-miR-10a	CLIP-seq
MIRT2453570	hsa-miR-10b	CLIP-seq
MIRT1124320	hsa-miR-1268	CLIP-seq
MIRT1124321	hsa-miR-1268b	CLIP-seq
MIRT1124322	hsa-miR-1273	CLIP-seq
MIRT1124323	hsa-miR-1293	CLIP-seq
MIRT1124325	hsa-miR-1908	CLIP-seq
MIRT1124327	hsa-miR-3122	CLIP-seq
MIRT1124328	hsa-miR-3165	CLIP-seq
MIRT2453571	hsa-miR-339-5p	CLIP-seq
MIRT1124329	hsa-miR-3689a-3p	CLIP-seq
MIRT1124330	hsa-miR-3689c	CLIP-seq
MIRT2564912	hsa-miR-371-5p	CLIP-seq
MIRT1124331	hsa-miR-3913-5p	CLIP-seq
MIRT1124333	hsa-miR-3974	CLIP-seq
MIRT2453572	hsa-miR-4421	CLIP-seq
MIRT1124336	hsa-miR-4433	CLIP-seq
MIRT1124337	hsa-miR-4457	CLIP-seq
MIRT1124338	hsa-miR-4459	CLIP-seq
MIRT1124340	hsa-miR-4483	CLIP-seq
MIRT1124344	hsa-miR-4683	CLIP-seq
MIRT2453573	hsa-miR-4684-5p	CLIP-seq
MIRT1124347	hsa-miR-4728-5p	CLIP-seq
MIRT1124349	hsa-miR-4767	CLIP-seq
MIRT1124350	hsa-miR-4768-3p	CLIP-seq
MIRT1124351	hsa-miR-4786-5p	CLIP-seq
MIRT1124352	hsa-miR-4793-5p	CLIP-seq
MIRT1124353	hsa-miR-4794	CLIP-seq
MIRT1124355	hsa-miR-513b	CLIP-seq
MIRT1124358	hsa-miR-548c-3p	CLIP-seq
MIRT2453574	hsa-miR-593	CLIP-seq
MIRT1124360	hsa-miR-624	CLIP-seq
MIRT1124361	hsa-miR-663	CLIP-seq
MIRT1124362	hsa-miR-766	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
SP1	Unknown	15504356

Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003796	Function	Lysozyme activity	IBA
GO:0003796	Function	Lysozyme activity	IEA
GO:0003796	Function	Lysozyme activity	TAS	2829884
GO:0003824	Function	Catalytic activity	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	16502470, 22664934, 23580065
GO:0005615	Component	Extracellular space	IDA	21805676
GO:0005615	Component	Extracellular space	TAS	2829884
GO:0006954	Process	Inflammatory response	TAS	366724
GO:0016787	Function	Hydrolase activity	IEA
GO:0016798	Function	Hydrolase activity, acting on glycosyl bonds	IEA
GO:0019730	Process	Antimicrobial humoral response	TAS
GO:0031640	Process	Killing of cells of another organism	IDA	9727055
GO:0031640	Process	Killing of cells of another organism	IEA
GO:0035578	Component	Azurophil granule lumen	TAS
GO:0035580	Component	Specific granule lumen	TAS
GO:0042742	Process	Defense response to bacterium	IDA	21093056
GO:0042742	Process	Defense response to bacterium	IEA
GO:0042802	Function	Identical protein binding	IPI	23353684
GO:0050829	Process	Defense response to Gram-negative bacterium	IBA
GO:0050830	Process	Defense response to Gram-positive bacterium	IBA
GO:0050830	Process	Defense response to Gram-positive bacterium	IDA	21093056
GO:0070062	Component	Extracellular exosome	HDA	19056867, 19199708, 23533145
GO:1904724	Component	Tertiary granule lumen	TAS

MIM	HGNC	e!Ensembl
153450	6740	ENSG00000090382

P61626

Protein name

Lysozyme C (EC 3.2.1.17) (1,4-beta-N-acetylmuramidase C)

Protein function

Lysozymes have primarily a bacteriolytic function; those in tissues and body fluids are associated with the monocyte-macrophage system and enhance the activity of immunoagents.

PDB

133L , 134L , 1B5U , 1B5V , 1B5W , 1B5X , 1B5Y , 1B5Z , 1B7L , 1B7M , 1B7N , 1B7O , 1B7P , 1B7Q , 1B7R , 1B7S , 1BB3 , 1BB4 , 1BB5 , 1C43 , 1C45 , 1C46 , 1C7P , 1CJ6 , 1CJ7 , 1CJ8 , 1CJ9 , 1CKC , 1CKD , 1CKF , 1CKG , 1CKH , 1D6P , 1D6Q , 1DI3 , 1DI4 , 1DI5 , 1EQ4 , 1EQ5 , 1EQE , 1GAY , 1GAZ , 1GB0 , 1GB2 , 1GB3 , 1GB5 , 1GB6 , 1GB7 , 1GB8 , 1GB9 , 1GBO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00062	Lys	19 → 146	C-type lysozyme/alpha-lactalbumin family	Domain

Sequence

MKALIVLGLVLLSVTVQGKVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRA
TNYNAGDRSTDYGIFQINSRYWCNDGKTPGAVNACHLSCSALLQDNIADAVACAKRVVRD
PQGIRAWVAWRNRCQNRDVRQYVQGCGV

Sequence length

148

Interactions

View interactions

	KEGG		Reactome
	Salivary secretion		Neutrophil degranulation Antimicrobial peptides Amyloid fiber formation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Amyloidosis, hereditary systemic 5	Pathogenic	rs121913547, rs121913549	RCV004555833 RCV004555835	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Familial visceral amyloidosis, Ostertag type	Pathogenic	rs387906536	RCV000015452 RCV000015454	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALYS AMYLOIDOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMYLOIDOSIS, FAMILIAL VISCERAL	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL VISCERAL AMYLOIDOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (163)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acne	Acne	BEFREE	28117399, 30082920		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acne Vulgaris	Acne	BEFREE	28117399, 30082920		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	12070599, 9543668		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	BEFREE	9129700		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	9543668		★★★★★ ★☆☆☆☆ Found in Text Mining only
ALys amyloidosis	ALys amyloidosis	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer Disease	Alzheimer disease	Pubtator	27249223, 27327445	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloid nephropathy	Amyloid Nephropathy	BEFREE	10534505, 12675840, 8270767		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloid Neuropathies Familial	Amyloid neuropathy	Pubtator	12675840, 17407782	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	10534505, 12360495, 12668424, 15713462, 16126226, 16329101, 21965601, 21988333, 22978355, 25217048, 27428539, 28049649, 28272865, 2837542, 28827166 View all (9 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	Pubtator	16126226, 21818368, 28049649, 29455155, 37833900	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	LHGDN	16329101		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis Familial	Amyloidosis	Pubtator	11849445, 12050338, 12675840, 20382744, 25217048, 29455155, 39511224	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis familial visceral	Visceral amyloidosis	Pubtator	12675840, 27926837	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis, Familial	Amyloidosis	BEFREE	11849445, 20382744, 25217048, 28049649, 31395023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis, familial visceral	Amyloidosis	GENOMICS_ENGLAND_DG	16523055, 1808634, 21988333		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyloidosis, familial visceral	Amyloidosis	UNIPROT_DG	8464497		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyloidosis, familial visceral	Amyloidosis	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyloidosis, familial visceral	Amyloidosis	CLINVAR_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anemia, Sickle Cell	Anemia	BEFREE	16570202		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	BEFREE	28068524		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	22797469	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	16816382		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	2596882, 26574972, 28978351		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	2596882	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	16816382		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	31173944		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	40185380	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	12054857, 15211072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	26890818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	28727388		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	3862425		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	29516756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12473177	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms Male	Male breast neoplasms	Pubtator	12473177	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	12054857		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic sinusitis	Sinusitis	BEFREE	22391076, 24121782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	12519391		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	12519391, 1427374	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	29556621, 33359089	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	34692829	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Corticobasal Degeneration	Corticobasal degeneration	Pubtator	27061067	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	22391076, 24121782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	11919217, 34529988	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	12519391, 1634071, 16989824, 20688803, 28770667, 31403980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	12519391, 1427374	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dacryocystitis	Dacryocystitis	BEFREE	28578578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dental Caries	Dental caries	Pubtator	26161606	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	30082920		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	23336209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	23336209, 29550545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28505540		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	24495950	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	37656997	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	24495950		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry eye syndrome	Pubtator	22736608	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
EAR, PATELLA, SHORT STATURE SYNDROME	Ear Diseases	BEFREE	31279118		★★★★★ ★☆☆☆☆ Found in Text Mining only
ECTODERMAL DYSPLASIA 10A, HYPOHIDROTIC/HAIR/NAIL TYPE, AUTOSOMAL DOMINANT	Ectodermal dysplasia	BEFREE	27378689		★★★★★ ★☆☆☆☆ Found in Text Mining only
ECTODERMAL DYSPLASIA 10B, HYPOHIDROTIC/HAIR/TOOTH TYPE, AUTOSOMAL RECESSIVE	Ectodermal Dysplasia	BEFREE	27378689		★★★★★ ★☆☆☆☆ Found in Text Mining only
ECTODERMAL DYSPLASIA 11A, HYPOHIDROTIC/HAIR/TOOTH TYPE, AUTOSOMAL DOMINANT	Ectodermal dysplasia	BEFREE	27378689		★★★★★ ★☆☆☆☆ Found in Text Mining only
ECTODERMAL DYSPLASIA 11B, HYPOHIDROTIC/HAIR/TOOTH TYPE, AUTOSOMAL RECESSIVE	Ectodermal dysplasia	BEFREE	27378689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Enteritis	Enteritis	BEFREE	31831090		★★★★★ ★☆☆☆☆ Found in Text Mining only
Enterocolitis Necrotizing	Enterocolitis	Pubtator	35410162	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Amyloid Neuropathy, Portuguese Type	Amyloid Neuropathy	BEFREE	21988333		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	26808498		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	25217048		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal Diseases	BEFREE	27037159		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	25217048	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	23041331		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingivitis	BEFREE	30845920		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	37108298	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	32687679, 33047898	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	11788708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gout	Gout	Pubtator	35359923	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	Pubtator	21412229	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	28419103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	28049649	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Histiocytosis, Langerhans-Cell	Histiocytosis	BEFREE	1285018		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	16816382		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	LHGDN	18434581		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	29364261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Ileitis	Ileitis	BEFREE	26487367, 27581119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	11919217, 1427374, 25217048	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	1634071, 25217048, 28323404, 30450689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	24013298	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	32556182	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	12480915	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	28954839		★★★★★ ★☆☆☆☆ Found in Text Mining only
Jaundice, Obstructive	Jaundice	BEFREE	31429688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	28577525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	21031023	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	11849445, 12360495, 26452890, 28377318		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	11849445, 38027143	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	30465656		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	34858345	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10889907, 26452890, 30784597, 31209550		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	10889907, 29286103	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	9858224	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10889907, 3036571, 9130686		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	11986950		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelomonocytic, Chronic	Myelomonocytic Leukemia	BEFREE	30465656		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukoplakia, Oral	Leukoplakia	BEFREE	27478070		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29227957		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	29227957		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	8736208	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	30560888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	37883760	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	31019506	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	20367305		★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	32974084	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Fibrous Histiocytoma	Malignant Histiocytoma	BEFREE	30360911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	29516756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	31332522		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mediastinal Germ Cell Tumor	Mediastinal Tumor	BEFREE	16809892		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	25944800	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	29363671		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	11714920, 14632572, 20382744, 20958028, 23919586, 26884716, 39511224	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	35049167	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	24190443	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	35802752	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	23709377, 33506054	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	1525759, 1728194, 23032949, 28729694, 30621725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	28377318		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	28049649		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oral Ulcer	Oral Ulcer	GWASCAT_DG	30837455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis, Acute Necrotizing	Necrotizing pancreatitis	BEFREE	28441432		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paratuberculosis	Paratuberculosis	BEFREE	11118736		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	27061067	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	28797303		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	28963698		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	28963698		★★★★★ ★☆☆☆☆ Found in Text Mining only
Petechiae	Petechiae	BEFREE	10534505		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyglandular Type I Autoimmune Syndrome	Polyglandular autoimmune syndrome	BEFREE	31715244		★★★★★ ★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	24661442		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	16551973		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prion Diseases	Prion disease	Pubtator	35359923	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	25332209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	25332209	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	36655999	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal glomerular disease	Renal Glomerular Disease	BEFREE	7922183		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	2596882		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	28295528, 29121154, 30632406, 30944672		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	8736208	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	17208486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Shwachman syndrome	Shwachman Syndrome	BEFREE	28917670		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sicca Syndrome	Sjogren`s Syndrome	BEFREE	22978355, 28049649, 28963698		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	25332209	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	25332209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	40591022	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	33361747	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	31332522		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	22133303	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Supranuclear Palsy Progressive	Progressive supranuclear palsy	Pubtator	27061067	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	31801935	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	28419103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Typhlitis	Typhlitis	BEFREE	12519391		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	12519391, 1634071, 31403980		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ventricular Fibrillation	Ventricular fibrillation	Pubtator	23919586	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitamin A Deficiency	Vitamin A Deficiency	BEFREE	10100988		★★★★★ ★☆☆☆☆ Found in Text Mining only

LYZ (lysozyme)