LYN (LYN proto-oncogene, Src family tyrosine kinase)

Gene

• Entrez ID: 4067
• Gene name: LYN proto-oncogene, Src family tyrosine kinase
• Gene symbol: LYN
• Synonyms (NCBI Gene): JTK8, SAIDV, p53Lyn, p56Lyn
• Chromosome: 8
• Chromosome location: 8q12.1
• Summary: This gene encodes a tyrosine protein kinase, which maybe involved in the regulation of mast cell degranulation, and erythroid differentiation. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided b

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT046575	hsa-miR-222-3p	CLASH	23622248
MIRT322915	hsa-miR-32-3p	PAR-CLIP	20371350
MIRT322916	hsa-miR-4731-3p	PAR-CLIP	20371350
MIRT322917	hsa-miR-4801	PAR-CLIP	20371350
MIRT570814	hsa-miR-4789-3p	PAR-CLIP	20371350
MIRT570813	hsa-miR-4643	PAR-CLIP	20371350
MIRT570812	hsa-miR-187-5p	PAR-CLIP	20371350
MIRT570811	hsa-miR-548v	PAR-CLIP	20371350
MIRT570810	hsa-miR-221-3p	PAR-CLIP	20371350
MIRT046575	hsa-miR-222-3p	PAR-CLIP	20371350
MIRT570809	hsa-miR-466	PAR-CLIP	20371350
MIRT570808	hsa-miR-628-5p	PAR-CLIP	20371350
MIRT322922	hsa-miR-548c-3p	PAR-CLIP	23592263
MIRT473950	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT473949	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT473948	hsa-miR-6805-5p	PAR-CLIP	23592263
MIRT473947	hsa-miR-6732-5p	PAR-CLIP	23592263
MIRT473946	hsa-miR-10b-3p	PAR-CLIP	23592263
MIRT473945	hsa-miR-4330	PAR-CLIP	23592263
MIRT473944	hsa-let-7a-5p	PAR-CLIP	23592263
MIRT473943	hsa-let-7b-5p	PAR-CLIP	23592263
MIRT473942	hsa-let-7c-5p	PAR-CLIP	23592263
MIRT473941	hsa-let-7d-5p	PAR-CLIP	23592263
MIRT473940	hsa-let-7e-5p	PAR-CLIP	23592263
MIRT473939	hsa-let-7f-5p	PAR-CLIP	23592263
MIRT473938	hsa-let-7g-5p	PAR-CLIP	23592263
MIRT473937	hsa-let-7i-5p	PAR-CLIP	23592263
MIRT473936	hsa-miR-4458	PAR-CLIP	23592263
MIRT473935	hsa-miR-4500	PAR-CLIP	23592263
MIRT473934	hsa-miR-98-5p	PAR-CLIP	23592263
MIRT473932	hsa-miR-3148	PAR-CLIP	23592263
MIRT473933	hsa-miR-4668-5p	PAR-CLIP	23592263
MIRT473931	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT473930	hsa-miR-4278	PAR-CLIP	23592263
MIRT473929	hsa-miR-450a-1-3p	PAR-CLIP	23592263
MIRT473928	hsa-miR-3122	PAR-CLIP	23592263
MIRT473927	hsa-miR-3913-5p	PAR-CLIP	23592263
MIRT473926	hsa-miR-6513-5p	PAR-CLIP	23592263
MIRT440300	hsa-miR-205-5p	HITS-CLIP	22473208
MIRT440300	hsa-miR-205-5p	HITS-CLIP	22473208
MIRT322915	hsa-miR-32-3p	PAR-CLIP	20371350
MIRT322916	hsa-miR-4731-3p	PAR-CLIP	20371350
MIRT322917	hsa-miR-4801	PAR-CLIP	20371350
MIRT570814	hsa-miR-4789-3p	PAR-CLIP	20371350
MIRT570813	hsa-miR-4643	PAR-CLIP	20371350
MIRT570812	hsa-miR-187-5p	PAR-CLIP	20371350
MIRT570811	hsa-miR-548v	PAR-CLIP	20371350
MIRT570810	hsa-miR-221-3p	PAR-CLIP	20371350
MIRT046575	hsa-miR-222-3p	PAR-CLIP	20371350
MIRT570809	hsa-miR-466	PAR-CLIP	20371350
MIRT570808	hsa-miR-628-5p	PAR-CLIP	20371350
MIRT322922	hsa-miR-548c-3p	PAR-CLIP	23592263
MIRT473950	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT473949	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT473948	hsa-miR-6805-5p	PAR-CLIP	23592263
MIRT473947	hsa-miR-6732-5p	PAR-CLIP	23592263
MIRT473946	hsa-miR-10b-3p	PAR-CLIP	23592263
MIRT473945	hsa-miR-4330	PAR-CLIP	23592263
MIRT473944	hsa-let-7a-5p	PAR-CLIP	23592263
MIRT473943	hsa-let-7b-5p	PAR-CLIP	23592263
MIRT473942	hsa-let-7c-5p	PAR-CLIP	23592263
MIRT473941	hsa-let-7d-5p	PAR-CLIP	23592263
MIRT473940	hsa-let-7e-5p	PAR-CLIP	23592263
MIRT473939	hsa-let-7f-5p	PAR-CLIP	23592263
MIRT473938	hsa-let-7g-5p	PAR-CLIP	23592263
MIRT473937	hsa-let-7i-5p	PAR-CLIP	23592263
MIRT473936	hsa-miR-4458	PAR-CLIP	23592263
MIRT473935	hsa-miR-4500	PAR-CLIP	23592263
MIRT473934	hsa-miR-98-5p	PAR-CLIP	23592263
MIRT473932	hsa-miR-3148	PAR-CLIP	23592263
MIRT473933	hsa-miR-4668-5p	PAR-CLIP	23592263
MIRT473931	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT473930	hsa-miR-4278	PAR-CLIP	23592263
MIRT473929	hsa-miR-450a-1-3p	PAR-CLIP	23592263
MIRT473928	hsa-miR-3122	PAR-CLIP	23592263
MIRT473927	hsa-miR-3913-5p	PAR-CLIP	23592263
MIRT473926	hsa-miR-6513-5p	PAR-CLIP	23592263
MIRT1123088	hsa-miR-1200	CLIP-seq
MIRT1123089	hsa-miR-1237	CLIP-seq
MIRT1123090	hsa-miR-1248	CLIP-seq
MIRT1123091	hsa-miR-1303	CLIP-seq
MIRT1123092	hsa-miR-1976	CLIP-seq
MIRT1123093	hsa-miR-2116	CLIP-seq
MIRT1123094	hsa-miR-3190	CLIP-seq
MIRT1123095	hsa-miR-3201	CLIP-seq
MIRT1123096	hsa-miR-3591-5p	CLIP-seq
MIRT1123097	hsa-miR-3606	CLIP-seq
MIRT1123098	hsa-miR-3646	CLIP-seq
MIRT1123099	hsa-miR-4282	CLIP-seq
MIRT1123100	hsa-miR-4324	CLIP-seq
MIRT1123101	hsa-miR-4496	CLIP-seq
MIRT1123102	hsa-miR-4677-5p	CLIP-seq
MIRT1123103	hsa-miR-4700-3p	CLIP-seq
MIRT1123104	hsa-miR-4715-3p	CLIP-seq
MIRT1123105	hsa-miR-4722-3p	CLIP-seq
MIRT1123106	hsa-miR-4752	CLIP-seq
MIRT1123107	hsa-miR-4768-3p	CLIP-seq
MIRT1123108	hsa-miR-4791	CLIP-seq
MIRT1123109	hsa-miR-4799-5p	CLIP-seq
MIRT1123110	hsa-miR-5095	CLIP-seq
MIRT1123111	hsa-miR-544b	CLIP-seq
MIRT1123112	hsa-miR-600	CLIP-seq
MIRT1123113	hsa-miR-609	CLIP-seq
MIRT1123114	hsa-miR-877	CLIP-seq
MIRT1123115	hsa-miR-921	CLIP-seq
MIRT2034745	hsa-miR-3622a-3p	CLIP-seq
MIRT2034746	hsa-miR-3622b-3p	CLIP-seq
MIRT2034747	hsa-miR-412	CLIP-seq
MIRT2034748	hsa-miR-617	CLIP-seq
MIRT2265253	hsa-miR-2278	CLIP-seq
MIRT2265254	hsa-miR-2467-5p	CLIP-seq
MIRT2265255	hsa-miR-3188	CLIP-seq
MIRT2265256	hsa-miR-3975	CLIP-seq
MIRT2265257	hsa-miR-4303	CLIP-seq
MIRT2265258	hsa-miR-4649-3p	CLIP-seq
MIRT2265259	hsa-miR-4762-3p	CLIP-seq
MIRT2265260	hsa-miR-485-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000077	Process	DNA damage checkpoint signaling	IDA	10891478
GO:0000166	Function	Nucleotide binding	IEA
GO:0000902	Process	Cell morphogenesis	IEA
GO:0001782	Process	B cell homeostasis	IEA
GO:0001782	Process	B cell homeostasis	ISS
GO:0001817	Process	Regulation of cytokine production	IEA
GO:0001817	Process	Regulation of cytokine production	ISS
GO:0001932	Process	Regulation of protein phosphorylation	TAS	15489917
GO:0001933	Process	Negative regulation of protein phosphorylation	ISS
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	TAS
GO:0002244	Process	Hematopoietic progenitor cell differentiation	IMP	16467205
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002431	Process	Fc receptor mediated stimulatory signaling pathway	IBA
GO:0002431	Process	Fc receptor mediated stimulatory signaling pathway	IEA
GO:0002431	Process	Fc receptor mediated stimulatory signaling pathway	ISS
GO:0002513	Process	Tolerance induction to self antigen	IBA
GO:0002513	Process	Tolerance induction to self antigen	IEA
GO:0002513	Process	Tolerance induction to self antigen	ISS
GO:0002513	Process	Tolerance induction to self antigen	TAS	15489917
GO:0002553	Process	Histamine secretion by mast cell	IEA
GO:0002576	Process	Platelet degranulation	IEA
GO:0002576	Process	Platelet degranulation	ISS
GO:0002758	Process	Innate immune response-activating signaling pathway	IEA
GO:0002762	Process	Negative regulation of myeloid leukocyte differentiation	IEA
GO:0002768	Process	Immune response-regulating cell surface receptor signaling pathway	IEA
GO:0002768	Process	Immune response-regulating cell surface receptor signaling pathway	ISS
GO:0002768	Process	Immune response-regulating cell surface receptor signaling pathway	TAS	15489917
GO:0002774	Process	Fc receptor mediated inhibitory signaling pathway	IEA
GO:0002774	Process	Fc receptor mediated inhibitory signaling pathway	ISS
GO:0002862	Process	Negative regulation of inflammatory response to antigenic stimulus	IEA
GO:0002862	Process	Negative regulation of inflammatory response to antigenic stimulus	TAS
GO:0002902	Process	Regulation of B cell apoptotic process	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	EXP	1381360, 7526393, 9799234, 10861086, 11110698, 11358993, 11448999, 12670955, 12923167, 16921024, 18697750
GO:0004713	Function	Protein tyrosine kinase activity	IDA	7682714, 10748115, 11823534, 32958780
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	IMP	36122175, 36932076
GO:0004713	Function	Protein tyrosine kinase activity	TAS	3561390
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IBA
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IEA
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IMP	23555801
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	TAS
GO:0005102	Function	Signaling receptor binding	IBA
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005161	Function	Platelet-derived growth factor receptor binding	IEA
GO:0005178	Function	Integrin binding	IEA
GO:0005515	Function	Protein binding	IPI	1715582, 7859737, 8647200, 8753773, 9020138, 11306681, 11517336, 11782428, 14993658, 15546919, 15784897, 16155203, 16374509, 16799092, 17254966, 17640867, 18070987, 19940238, 20037584, 20159608, 21930792, 22581261, 22624718, 22731636, 22939624, 23001182, 23764002, 23866081, 24658140
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	18817770
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	TAS
GO:0005794	Component	Golgi apparatus	IDA	15173188, 20605918
GO:0005794	Component	Golgi apparatus	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	32958780
GO:0005886	Component	Plasma membrane	IDA	15173188, 20605918
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005912	Component	Adherens junction	IEA
GO:0006468	Process	Protein phosphorylation	IDA	11517336
GO:0006468	Process	Protein phosphorylation	TAS	3561390
GO:0006914	Process	Autophagy	IEA
GO:0006950	Process	Response to stress	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0006974	Process	DNA damage response	IBA
GO:0006974	Process	DNA damage response	IDA	11517336
GO:0006991	Process	Response to sterol depletion	IEA
GO:0007165	Process	Signal transduction	TAS	7650013
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IBA
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IMP	14726379
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	ISS
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IMP	14726379
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009636	Process	Response to toxic substance	IEA
GO:0009725	Process	Response to hormone	IEA
GO:0009725	Process	Response to hormone	ISS
GO:0009743	Process	Response to carbohydrate	IEA
GO:0009898	Component	Cytoplasmic side of plasma membrane	IDA	11823534
GO:0009898	Component	Cytoplasmic side of plasma membrane	IEA
GO:0010976	Process	Positive regulation of neuron projection development	IMP	17910947
GO:0014003	Process	Oligodendrocyte development	IEA
GO:0015908	Process	Fatty acid transport	IDA	32958780
GO:0015908	Process	Fatty acid transport	IDA	32958780
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016301	Function	Kinase activity	NAS	24217950
GO:0016740	Function	Transferase activity	IEA
GO:0017124	Function	SH3 domain binding	IEA
GO:0018108	Process	Peptidyl-tyrosine phosphorylation	IDA	7682714, 11782428
GO:0019899	Function	Enzyme binding	IEA
GO:0019899	Function	Enzyme binding	IPI	20605918
GO:0030061	Component	Mitochondrial crista	IEA
GO:0030097	Process	Hemopoiesis	IEA
GO:0030218	Process	Erythrocyte differentiation	IEA
GO:0030218	Process	Erythrocyte differentiation	ISS
GO:0030222	Process	Eosinophil differentiation	IDA	11823534
GO:0030335	Process	Positive regulation of cell migration	IEA
GO:0030546	Function	Signaling receptor activator activity	IDA	24217950
GO:0030666	Component	Endocytic vesicle membrane	TAS
GO:0030889	Process	Negative regulation of B cell proliferation	IEA
GO:0031175	Process	Neuron projection development	IBA
GO:0031175	Process	Neuron projection development	IEA
GO:0031295	Process	T cell costimulation	TAS
GO:0031625	Function	Ubiquitin protein ligase binding	IEA
GO:0031663	Process	Lipopolysaccharide-mediated signaling pathway	IEA
GO:0031663	Process	Lipopolysaccharide-mediated signaling pathway	ISS
GO:0031966	Component	Mitochondrial membrane	IEA
GO:0032868	Process	Response to insulin	IEA
GO:0032991	Component	Protein-containing complex	IEA
GO:0033003	Process	Regulation of mast cell activation	IEA
GO:0033003	Process	Regulation of mast cell activation	ISS
GO:0033628	Process	Regulation of cell adhesion mediated by integrin	IMP	18802065
GO:0034136	Process	Negative regulation of toll-like receptor 2 signaling pathway	IEA
GO:0034136	Process	Negative regulation of toll-like receptor 2 signaling pathway	ISS
GO:0034142	Process	Toll-like receptor 4 signaling pathway	IEA
GO:0034144	Process	Negative regulation of toll-like receptor 4 signaling pathway	IEA
GO:0034144	Process	Negative regulation of toll-like receptor 4 signaling pathway	ISS
GO:0034605	Process	Cellular response to heat	IEA
GO:0034666	Component	Integrin alpha2-beta1 complex	IEA
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0038043	Process	Interleukin-5-mediated signaling pathway	IDA	11823534
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0038096	Process	Fc-gamma receptor signaling pathway involved in phagocytosis	IEA
GO:0038096	Process	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS
GO:0038159	Process	C-X-C chemokine receptor CXCR4 signaling pathway	IMP	16467205
GO:0042100	Process	B cell proliferation	ISS
GO:0042100	Process	B cell proliferation	ISS
GO:0042327	Process	Positive regulation of phosphorylation	IEA
GO:0043015	Function	Gamma-tubulin binding	IEA
GO:0043200	Process	Response to amino acid	IEA
GO:0043208	Function	Glycosphingolipid binding	IEA
GO:0043304	Process	Regulation of mast cell degranulation	IEA
GO:0043304	Process	Regulation of mast cell degranulation	ISS
GO:0043407	Process	Negative regulation of MAP kinase activity	ISS
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	10891478
GO:0043434	Process	Response to peptide hormone	IEA
GO:0044325	Function	Transmembrane transporter binding	IPI	12538589
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0045121	Component	Membrane raft	IDA	11313396
GO:0045121	Component	Membrane raft	IEA
GO:0045121	Component	Membrane raft	ISS
GO:0045646	Process	Regulation of erythrocyte differentiation	IEA
GO:0045646	Process	Regulation of erythrocyte differentiation	ISS
GO:0046777	Process	Protein autophosphorylation	IDA	7682714
GO:0046875	Function	Ephrin receptor binding	IPI	24217950
GO:0048013	Process	Ephrin receptor signaling pathway	IGI	24217950
GO:0048013	Process	Ephrin receptor signaling pathway	TAS
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	20605918
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048678	Process	Response to axon injury	IEA
GO:0050727	Process	Regulation of inflammatory response	IEA
GO:0050777	Process	Negative regulation of immune response	TAS	15489917
GO:0050853	Process	B cell receptor signaling pathway	IEA
GO:0050855	Process	Regulation of B cell receptor signaling pathway	IBA
GO:0050855	Process	Regulation of B cell receptor signaling pathway	IEA
GO:0050855	Process	Regulation of B cell receptor signaling pathway	ISS
GO:0050859	Process	Negative regulation of B cell receptor signaling pathway	IDA	1711157, 35941532
GO:0050900	Process	Leukocyte migration	IEA
GO:0050900	Process	Leukocyte migration	TAS
GO:0051219	Function	Phosphoprotein binding	IEA
GO:0051279	Process	Regulation of release of sequestered calcium ion into cytosol	IEA
GO:0051279	Process	Regulation of release of sequestered calcium ion into cytosol	IEA
GO:0060252	Process	Positive regulation of glial cell proliferation	IEA
GO:0060369	Process	Positive regulation of Fc receptor mediated stimulatory signaling pathway	IEA
GO:0060397	Process	Growth hormone receptor signaling pathway via JAK-STAT	TAS
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0070372	Process	Regulation of ERK1 and ERK2 cascade	IEA
GO:0070372	Process	Regulation of ERK1 and ERK2 cascade	ISS
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IEA
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	ISS
GO:0070447	Process	Positive regulation of oligodendrocyte progenitor proliferation	IEA
GO:0070667	Process	Negative regulation of mast cell proliferation	IEA
GO:0070667	Process	Negative regulation of mast cell proliferation	ISS
GO:0070668	Process	Positive regulation of mast cell proliferation	IMP	11435302
GO:0071300	Process	Cellular response to retinoic acid	IMP	17910947
GO:0071396	Process	Cellular response to lipid	IEA
GO:0090025	Process	Regulation of monocyte chemotaxis	IMP	18802065
GO:0090330	Process	Regulation of platelet aggregation	IEA
GO:0090330	Process	Regulation of platelet aggregation	ISS
GO:0097028	Process	Dendritic cell differentiation	IBA
GO:0097028	Process	Dendritic cell differentiation	IEA
GO:0097028	Process	Dendritic cell differentiation	ISS
GO:0097110	Function	Scaffold protein binding	IPI	23555801
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099091	Component	Postsynaptic specialization, intracellular component	IEA
GO:0140031	Function	Phosphorylation-dependent protein binding	IPI	11782428
GO:0141038	Function	Phosphatidylinositol 3-kinase activator activity	IEA
GO:0150076	Process	Neuroinflammatory response	IEA
GO:1902532	Process	Negative regulation of intracellular signal transduction	IEA
GO:1902532	Process	Negative regulation of intracellular signal transduction	ISS
GO:1902993	Process	Positive regulation of amyloid precursor protein catabolic process	IMP	24217950
GO:1903078	Process	Positive regulation of protein localization to plasma membrane	IMP	31649195
GO:2000670	Process	Positive regulation of dendritic cell apoptotic process	IEA
GO:2000670	Process	Positive regulation of dendritic cell apoptotic process	ISS

Other IDs

• MIM: 165120
• HGNC: 6735
• e!Ensembl: ENSG00000254087

Protein

• UniProt ID: P07948
• Protein name: Tyrosine-protein kinase Lyn (EC 2.7.10.2) (Lck/Yes-related novel protein tyrosine kinase) (V-yes-1 Yamaguchi sarcoma viral related oncogene homolog) (p53Lyn) (p56Lyn)
• Protein function: Non-receptor tyrosine-protein kinase that transmits signals from cell surface receptors and plays an important role in the regulation of innate and adaptive immune responses, hematopoiesis, responses to growth factors and cytokines, integrin sig
• PDB: 1W1F, 1WA7, 3A4O, 5XY1, 6NMW, 8WFF
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00018	SH3_1	69 → 115	SH3 domain	Domain
  PF00017	SH2	129 → 211	SH2 domain	Domain
  PF07714	PK_Tyr_Ser-Thr	247 → 497	Protein tyrosine and serine/threonine kinase	Domain

• Tissue specificity: TISSUE SPECIFICITY: Detected in monocytes (at protein level). Detected in placenta, and in fetal brain, lung, liver and kidney. Widely expressed in a variety of organs, tissues, and cell types such as epidermoid, hematopoietic, and neuronal cells. Express
• Sequence:

  MGCIKSKGKDSLSDDGVDLKTQPVRNTERTIYVRDPTSNKQQRPVPESQLLPGQRFQTKD
  PEEQGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLLTKKEGFIPSNYVAK
  LNTLETEEWFFKDITRKDAERQLLAPGNSAGAFLIRESETLKGSFSLSVRDFDPVHGDVI
  KHYKIRSLDNGGYYISPRITFPCISDMIKHYQKQADGLCRRLEKACISPKPQKPWDKDAW
  EIPRESIKLVKRLGAGQFGEVWMGYYNNSTKVAVKTLKPGTMSVQAFLEEANLMKTLQHD
  KLVRLYAVVTREEPIYIITEYMAKGSLLDFLKSDEGGKVLLPKLIDFSAQIAEGMAYIER
  KNYIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGCF
  TIKSDVWSFGILLYEIVTYGKIPYPGRTNADVMTALSQGYRMPRVENCPDELYDIMKMCW
  KEKAEERPTFDYLQSVLDDFYTATEGQYQQQP

• Sequence length: 512

Pathways

KEGG:

Chemokine signaling pathway
NF-kappa B signaling pathway
Platelet activation
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
Long-term depression
Epithelial cell signaling in Helicobacter pylori infection
Kaposi sarcoma-associated herpesvirus infection
Epstein-Barr virus infection
Viral carcinogenesis
Lipid and atherosclerosis

Reactome:

GPVI-mediated activation cascade
Signaling by SCF-KIT
Regulation of KIT signaling
Cell surface interactions at the vascular wall
FCGR activation
PECAM1 interactions
Fc epsilon receptor (FCERI) signaling
Role of LAT2/NTAL/LAB on calcium mobilization
FCERI mediated MAPK activation
FCERI mediated Ca+2 mobilization
FCERI mediated NF-kB activation
CD28 co-stimulation
CTLA4 inhibitory signaling
EPHB-mediated forward signaling
EPHA-mediated growth cone collapse
EPH-ephrin mediated repulsion of cells
Dectin-2 family
CD209 (DC-SIGN) signaling
CD22 mediated BCR regulation
Cyclin D associated events in G1
Platelet Adhesion to exposed collagen
Erythropoietin activates Phosphoinositide-3-kinase (PI3K)
Erythropoietin activates RAS
Regulation of signaling by CBL
FCGR3A-mediated IL10 synthesis
FCGR3A-mediated phagocytosis
Growth hormone receptor signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Autoinflammatory disease, systemic, with vasculitis	Pathogenic	rs2486900565, rs1585690632, rs2486900588, rs2486900574	RCV003228812 RCV003228884 RCV003228813 RCV003228743	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
LYN kinase associated vasculopathy and liver fibrosis syndrome	Pathogenic	rs2486900565, rs1585690632, rs2486900588	RCV002512493 RCV002512494 RCV002512495	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYN-related disorder	Benign; Likely benign; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	16029452		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	27756880		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	27756880		★☆☆☆☆ Found in Text Mining only
Anovulation	Anovulation	Pubtator	40287692	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	28260035, 34122426	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	36215934, 36267464	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	LHGDN	16568084		★☆☆☆☆ Found in Text Mining only
Bone Resorption	Bone resorption	Pubtator	9844106	Associate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	33460396	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	20215510, 25401474, 30590041		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20215510, 30969999	Associate	★☆☆☆☆ Found in Text Mining only
Bruton type agammaglobulinemia	Bruton type agammaglobulinemia	Pubtator	10688822	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	26731115	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Mucoepidermoid	Mucoepidermoid carcinoma	Pubtator	23018873	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29937990		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	26984511, 40612864	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	28260035, 37644056	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	27690342		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	27690342		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	27728807, 31726100		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	29153093		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	20077526		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22731636, 35103068, 35414768, 40156411	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	31886261	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	35628588	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	24455749	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	32778679	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	25171927, 29022919		★☆☆☆☆ Found in Text Mining only
Epilepsy Temporal Lobe	Temporal lobe epilepsy	Pubtator	38166692	Associate	★☆☆☆☆ Found in Text Mining only
Fibromatosis, Aggressive	Fibromatosis	BEFREE	16440290		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	37108401	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	15994925, 26744869		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	22323579, 26744869	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	15994925, 26744869		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	23975833		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	35628503	Associate	★☆☆☆☆ Found in Text Mining only
Granulomatous Disease Chronic	Granulomatous disease	Pubtator	8798554	Inhibit	★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	19369946	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	19290526	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	24352878	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	12881301	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	GWASCAT_DG	28498854		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	36643579	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	36193061	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	26984511	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	10658677, 15175350, 1638019, 17218385, 20564182, 22768161, 26308964, 29153093, 30969999, 36899005, 8611704	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	15650771	Stimulate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	18577747		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	1638019, 34836491	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	18056483, 20693279, 24404189, 26065685, 29153093, 31790499, 33592500, 34207065	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	26886259	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	16029452, 23896410, 29153093		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	1379847		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	36932076	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	16320343, 23450709	Inhibit	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	17195233, 19369946	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	16320343		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASDB_DG	18204446		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	19369946		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	40156411	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	LHGDN	18768392		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	12586738, 16373702, 8264235		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	15665117, 15744341, 18070987		★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	35030632	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	20215510, 25401474, 30590041		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29937990		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	24817628		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	26460485, 31828293		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19732844, 22194994, 23936469, 25401474, 27690342, 29153093		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	27690342		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12642697		★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	Pubtator	21108325	Associate	★☆☆☆☆ Found in Text Mining only
Mastocytosis Systemic	Systemic mastocytosis	Pubtator	21680801	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	30969999	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	22354875		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	15175350	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	25029526	Associate	★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	19290526	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	18577747, 20583816, 24091144, 25965880		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	LHGDN	18577747		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	29153093		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	29643704		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17943972, 19893451, 23383610, 27690342, 27728807, 30590041		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	1510669		★☆☆☆☆ Found in Text Mining only
Nodular fasciitis	Nodular Fasciitis	BEFREE	16440290		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	27756880, 29937990		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	24455749	Associate	★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	25401474		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	23383610	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	33213062	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	40016711	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	28949383		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	28949383	Stimulate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	40287692	Associate	★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	24404189	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	24817628		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	24817628	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	29757188		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	34122426	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	22461510	Associate	★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	38166692	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	12771142, 24192080	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	27798955		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	26460485, 31828293		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26460485, 31828293	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	25482942	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	21859567		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	34517533	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	36991000	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	27690342, 33829064	Associate	★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom macroglobulinemia	Pubtator	24366360, 35255496	Associate	★☆☆☆☆ Found in Text Mining only