LY9 (lymphocyte antigen 9)

Gene

• Entrez ID: 4063
• Gene name: Lymphocyte antigen 9
• Gene symbol: LY9
• Synonyms (NCBI Gene): CD229, SLAMF3, hly9, mLY9
• Chromosome: 1
• Chromosome location: 1q23.3
• Summary: LY9 belongs to the SLAM family of immunomodulatory receptors (see SLAMF1; MIM 603492) and interacts with the adaptor molecule SAP (SH2D1A; MIM 300490) (Graham et al., 2006 [PubMed 16365421]).[supplied by OMIM, Mar 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1123061	hsa-miR-151-5p	CLIP-seq
MIRT1123062	hsa-miR-151b	CLIP-seq
MIRT1123063	hsa-miR-3922-5p	CLIP-seq
MIRT1123064	hsa-miR-4286	CLIP-seq
MIRT1123065	hsa-miR-4294	CLIP-seq
MIRT1123066	hsa-miR-4457	CLIP-seq
MIRT1123067	hsa-miR-4731-3p	CLIP-seq
MIRT1123068	hsa-miR-4801	CLIP-seq
MIRT1123069	hsa-miR-924	CLIP-seq
MIRT2034728	hsa-miR-15a	CLIP-seq
MIRT2034729	hsa-miR-15b	CLIP-seq
MIRT2034730	hsa-miR-16	CLIP-seq
MIRT2034731	hsa-miR-195	CLIP-seq
MIRT2034732	hsa-miR-3177-5p	CLIP-seq
MIRT2034733	hsa-miR-34a	CLIP-seq
MIRT2034734	hsa-miR-34c-5p	CLIP-seq
MIRT1123063	hsa-miR-3922-5p	CLIP-seq
MIRT2034735	hsa-miR-424	CLIP-seq
MIRT2034736	hsa-miR-449a	CLIP-seq
MIRT2034737	hsa-miR-449b	CLIP-seq
MIRT2034738	hsa-miR-4524	CLIP-seq
MIRT2034739	hsa-miR-4787-5p	CLIP-seq
MIRT2034740	hsa-miR-486-3p	CLIP-seq
MIRT2034741	hsa-miR-497	CLIP-seq
MIRT2034742	hsa-miR-503	CLIP-seq
MIRT2034743	hsa-miR-646	CLIP-seq
MIRT2034744	hsa-miR-885-3p	CLIP-seq
MIRT2034728	hsa-miR-15a	CLIP-seq
MIRT2034729	hsa-miR-15b	CLIP-seq
MIRT2034730	hsa-miR-16	CLIP-seq
MIRT2034731	hsa-miR-195	CLIP-seq
MIRT2265250	hsa-miR-3200-5p	CLIP-seq
MIRT2034735	hsa-miR-424	CLIP-seq
MIRT2265251	hsa-miR-4303	CLIP-seq
MIRT2265252	hsa-miR-4468	CLIP-seq
MIRT2034741	hsa-miR-497	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0005886	Component	Plasma membrane	IDA	22184727
GO:0005886	Component	Plasma membrane	IEA
GO:0006955	Process	Immune response	IBA
GO:0007155	Process	Cell adhesion	IEA
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009986	Component	Cell surface	IEA
GO:0016020	Component	Membrane	IEA
GO:0032740	Process	Positive regulation of interleukin-17 production	IDA	22184727
GO:0042110	Process	T cell activation	IBA
GO:0045087	Process	Innate immune response	IEA
GO:0072540	Process	T-helper 17 cell lineage commitment	IDA	22184727

Other IDs

• MIM: 600684
• HGNC: 6730
• e!Ensembl: ENSG00000122224

Protein

• UniProt ID: Q9HBG7
• Protein name: T-lymphocyte surface antigen Ly-9 (Cell surface molecule Ly-9) (Lymphocyte antigen 9) (SLAM family member 3) (SLAMF3) (Signaling lymphocytic activation molecule 3) (CD antigen CD229)
• Protein function: Self-ligand receptor of the signaling lymphocytic activation molecule (SLAM) family. SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differentiation of a wide variety of immune cells and
• Tissue specificity: TISSUE SPECIFICITY: Increased surface expression on T-cells of systemic lupus erythematosus (SLE) patients. {ECO:0000269|PubMed:22184727}.
• Sequence:

  MVAPKSHTDDWAPGPFSSKPQRSQLQIFSSVLQTSLLFLLMGLRASGKDSAPTVVSGILG
  GSVTLPLNISVDTEIENVIWIGPKNALAFARPKENVTIMVKSYLGRLDITKWSYSLCISN
  LTLNDAGSYKAQINQRNFEVTTEEEFTLFVYEQLQEPQVTMKSVKVSENFSCNITLMCSV
  KGAEKSVLYSWTPREPHASESNGGSILTVSRTPCDPDLPYICTAQNPVSQRSSLPVHVGQ
  FCTDPGASRGGTTGETVVGVLGEPVTLPLALPACRDTEKVVWLFNTSIISKEREEAATAD
  PLIKSRDPYKNRVWVSSQDCSLKISQLKIEDAGPYHAYVCSEASSVTSMTHVTLLIYRRL
  RKPKITWSLRHSEDGICRISLTCSVEDGGNTVMYTWTPLQKEAVVSQGESHLNVSWRSSE
  NHPNLTCTASNPVSRSSHQFLSENICSGPERNTKLWIGLFLMVCLLCVGIFSWCIWKRKG
  RCSVPAFCSSQAEAPADTPEPTAGHTLYSVLSQGYEKLDTPLRPARQQPTPTSDSSSDSN
  LTTEEDEDRPEVHKPISGRYEVFDQVTQEGAGHDPAPEGQADYDPVTPYVTEVESVVGEN
  TMYAQVFNLQGKTPVSQKEESSATIYCSIRKPQVVPPPQQNDLEIPESPTYENFT

• Sequence length: 655

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LY9-related disorder	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multisystem inflammatory syndrome in children	risk factor	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Autoimmune Diseases	Autoimmune disease	Pubtator	22184727	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26799423, 27081035	Inhibit	★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	31332162	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	31332162	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	31332162		★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	31057553		★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	24927415	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	26001047		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	24376606, 26799423, 27081035		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	22184727, 22989874, 29020082	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	23956418, 26221972, 35603218	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	18216865		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	22184727, 22989874, 26221972, 27482100, 29020082		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	15879090	Associate	★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	26001047		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	21606160, 26001047, 30326256		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	21606160, 26001047	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	37903821	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	26799423		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	34461858, 35618786	Associate	★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	26799423		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	38096229	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	30352204	Associate	★☆☆☆☆ Found in Text Mining only