LUM (lumican)

Gene

• Entrez ID: 4060
• Gene name: Lumican
• Gene symbol: LUM
• Synonyms (NCBI Gene): LDC, SLRR2D
• Chromosome: 12
• Chromosome location: 12q21.33
• Summary: This gene encodes a member of the small leucine-rich proteoglycan (SLRP) family that includes decorin, biglycan, fibromodulin, keratocan, epiphycan, and osteoglycin. In these bifunctional molecules, the protein moiety binds collagen fibrils and the highly

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT735118	hsa-miR-450b-5p	qRT-PCR	31776299
MIRT1122429	hsa-miR-4282	CLIP-seq
MIRT1122430	hsa-miR-4330	CLIP-seq
MIRT1122431	hsa-miR-4760-3p	CLIP-seq
MIRT1122432	hsa-miR-490-5p	CLIP-seq
MIRT1122433	hsa-miR-548a-3p	CLIP-seq
MIRT1122434	hsa-miR-548e	CLIP-seq
MIRT1122435	hsa-miR-548f	CLIP-seq
MIRT1122436	hsa-miR-570	CLIP-seq
MIRT1122437	hsa-miR-642b	CLIP-seq
MIRT1550995	hsa-miR-4477a	CLIP-seq
MIRT1550996	hsa-miR-4803	CLIP-seq
MIRT2265158	hsa-miR-128	CLIP-seq
MIRT2430857	hsa-miR-21	CLIP-seq
MIRT2430858	hsa-miR-2116	CLIP-seq
MIRT2430859	hsa-miR-2964a-5p	CLIP-seq
MIRT2430860	hsa-miR-3163	CLIP-seq
MIRT2430861	hsa-miR-325	CLIP-seq
MIRT2430862	hsa-miR-3924	CLIP-seq
MIRT2430863	hsa-miR-4311	CLIP-seq
MIRT2430864	hsa-miR-4422	CLIP-seq
MIRT1550995	hsa-miR-4477a	CLIP-seq
MIRT2430865	hsa-miR-4677-5p	CLIP-seq
MIRT2430866	hsa-miR-4696	CLIP-seq
MIRT2430867	hsa-miR-4757-5p	CLIP-seq
MIRT2430868	hsa-miR-4777-5p	CLIP-seq
MIRT2430869	hsa-miR-4796-5p	CLIP-seq
MIRT1550996	hsa-miR-4803	CLIP-seq
MIRT2430870	hsa-miR-494	CLIP-seq
MIRT2430871	hsa-miR-507	CLIP-seq
MIRT2430872	hsa-miR-518d-5p	CLIP-seq
MIRT2430873	hsa-miR-519b-5p	CLIP-seq
MIRT2430874	hsa-miR-519c-5p	CLIP-seq
MIRT2430875	hsa-miR-520c-5p	CLIP-seq
MIRT2430876	hsa-miR-520d-5p	CLIP-seq
MIRT2430877	hsa-miR-524-5p	CLIP-seq
MIRT2430878	hsa-miR-526a	CLIP-seq
MIRT2430879	hsa-miR-557	CLIP-seq
MIRT2430880	hsa-miR-561	CLIP-seq
MIRT2430881	hsa-miR-578	CLIP-seq
MIRT2430882	hsa-miR-581	CLIP-seq
MIRT2430883	hsa-miR-590-5p	CLIP-seq
MIRT1122437	hsa-miR-642b	CLIP-seq
MIRT2430884	hsa-miR-802	CLIP-seq
MIRT2430860	hsa-miR-3163	CLIP-seq
MIRT1550996	hsa-miR-4803	CLIP-seq
MIRT1122437	hsa-miR-642b	CLIP-seq
MIRT2564137	hsa-miR-1245b-5p	CLIP-seq
MIRT2430858	hsa-miR-2116	CLIP-seq
MIRT2430859	hsa-miR-2964a-5p	CLIP-seq
MIRT2564138	hsa-miR-3142	CLIP-seq
MIRT2430860	hsa-miR-3163	CLIP-seq
MIRT2430864	hsa-miR-4422	CLIP-seq
MIRT2564139	hsa-miR-4446-5p	CLIP-seq
MIRT2564140	hsa-miR-4645-3p	CLIP-seq
MIRT2430865	hsa-miR-4677-5p	CLIP-seq
MIRT2564141	hsa-miR-4755-5p	CLIP-seq
MIRT2564142	hsa-miR-4763-5p	CLIP-seq
MIRT2430869	hsa-miR-4796-5p	CLIP-seq
MIRT1550996	hsa-miR-4803	CLIP-seq
MIRT2564143	hsa-miR-513a-3p	CLIP-seq
MIRT2430876	hsa-miR-520d-5p	CLIP-seq
MIRT2430877	hsa-miR-524-5p	CLIP-seq
MIRT2430881	hsa-miR-578	CLIP-seq
MIRT2430882	hsa-miR-581	CLIP-seq
MIRT2564144	hsa-miR-642a	CLIP-seq
MIRT1122437	hsa-miR-642b	CLIP-seq
MIRT2564145	hsa-miR-665	CLIP-seq
MIRT2564146	hsa-miR-936	CLIP-seq
MIRT2564137	hsa-miR-1245b-5p	CLIP-seq
MIRT2430857	hsa-miR-21	CLIP-seq
MIRT2430858	hsa-miR-2116	CLIP-seq
MIRT2430859	hsa-miR-2964a-5p	CLIP-seq
MIRT2564138	hsa-miR-3142	CLIP-seq
MIRT2430860	hsa-miR-3163	CLIP-seq
MIRT2430861	hsa-miR-325	CLIP-seq
MIRT2430862	hsa-miR-3924	CLIP-seq
MIRT1122429	hsa-miR-4282	CLIP-seq
MIRT2684296	hsa-miR-4307	CLIP-seq
MIRT1122430	hsa-miR-4330	CLIP-seq
MIRT2430864	hsa-miR-4422	CLIP-seq
MIRT2564139	hsa-miR-4446-5p	CLIP-seq
MIRT1550995	hsa-miR-4477a	CLIP-seq
MIRT2564140	hsa-miR-4645-3p	CLIP-seq
MIRT2430865	hsa-miR-4677-5p	CLIP-seq
MIRT2564141	hsa-miR-4755-5p	CLIP-seq
MIRT1122431	hsa-miR-4760-3p	CLIP-seq
MIRT2564142	hsa-miR-4763-5p	CLIP-seq
MIRT2430869	hsa-miR-4796-5p	CLIP-seq
MIRT1550996	hsa-miR-4803	CLIP-seq
MIRT1122432	hsa-miR-490-5p	CLIP-seq
MIRT2564143	hsa-miR-513a-3p	CLIP-seq
MIRT2430876	hsa-miR-520d-5p	CLIP-seq
MIRT2430877	hsa-miR-524-5p	CLIP-seq
MIRT2430881	hsa-miR-578	CLIP-seq
MIRT2430882	hsa-miR-581	CLIP-seq
MIRT2430883	hsa-miR-590-5p	CLIP-seq
MIRT2564144	hsa-miR-642a	CLIP-seq
MIRT1122437	hsa-miR-642b	CLIP-seq
MIRT2564145	hsa-miR-665	CLIP-seq
MIRT2564146	hsa-miR-936	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005201	Function	Extracellular matrix structural constituent	NAS	10892350
GO:0005515	Function	Protein binding	IPI	25304424, 32814053
GO:0005518	Function	Collagen binding	IBA
GO:0005518	Function	Collagen binding	IDA	10892350
GO:0005576	Component	Extracellular region	HDA	27068509
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	NAS	14718574
GO:0005576	Component	Extracellular region	TAS
GO:0005583	Component	Fibrillar collagen trimer	IDA	10734230
GO:0005615	Component	Extracellular space	HDA	20551380
GO:0005615	Component	Extracellular space	IBA
GO:0005796	Component	Golgi lumen	TAS
GO:0007601	Process	Visual perception	TAS	10802664
GO:0030021	Function	Extracellular matrix structural constituent conferring compression resistance	ISS
GO:0030021	Function	Extracellular matrix structural constituent conferring compression resistance	RCA	20551380, 25037231, 27559042, 28675934
GO:0030199	Process	Collagen fibril organization	NAS	10892350
GO:0031012	Component	Extracellular matrix	HDA	20551380
GO:0031012	Component	Extracellular matrix	HDA	25037231, 27559042, 28675934
GO:0031012	Component	Extracellular matrix	IEA
GO:0031012	Component	Extracellular matrix	ISS	22261194
GO:0031012	Component	Extracellular matrix	TAS	7665616
GO:0032914	Process	Positive regulation of transforming growth factor beta1 production	IEA
GO:0043202	Component	Lysosomal lumen	TAS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0051216	Process	Cartilage development	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0070848	Process	Response to growth factor	IEA
GO:1904010	Process	Response to Aroclor 1254	IEA

Other IDs

• MIM: 600616
• HGNC: 6724
• e!Ensembl: ENSG00000139329

Protein

• UniProt ID: P51884
• Protein name: Lumican (Keratan sulfate proteoglycan lumican) (KSPG lumican)
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01462	LRRNT	36 → 66	Leucine rich repeat N-terminal domain	Family
  PF13855	LRR_8	67 → 102	Leucine rich repeat	Repeat
  PF13855	LRR_8	136 → 171	Leucine rich repeat	Repeat
  PF13516	LRR_6	182 → 197	Leucine Rich repeat	Repeat
  PF13855	LRR_8	205 → 266	Leucine rich repeat	Repeat

• Tissue specificity: TISSUE SPECIFICITY: Cornea and other tissues.
• Sequence:

  MSLSAFTLFLALIGGTSGQYYDYDFPLSIYGQSSPNCAPECNCPESYPSAMYCDELKLKS
  VPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGRVFSKLKQLKK
  LHINHNNLTESVGPLPKSLEDLQLTHNKITKLGSFEGLVNLTFIHLQHNRLKEDAVSAAF
  KGLKSLEYLDLSFNQIARLPSGLPVSLLTLYLDNNKISNIPDEYFKRFNALQYLRLSHNE
  LADSGIPGNSFNVSSLVELDLSYNKLKNIPTVNENLENYYLEVNQLEKFDIKSFCKILGP
  LSYSKIKHLRLDGNRISETSLPPDMYECLRVANEVTLN

• Sequence length: 338

Pathways

KEGG:

Proteoglycans in cancer

Reactome:

Keratan sulfate biosynthesis
Keratan sulfate degradation
Integrin cell surface interactions
Defective CHST6 causes MCDC1
Defective ST3GAL3 causes MCT12 and EIEE15
Defective B4GALT1 causes B4GALT1-CDG (CDG-2d)

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CAROTID ARTERY DISEASES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUM-related disorder	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	19020750, 25961303		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	19020750		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	22814255		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	19020750, 25961303		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	19843670, 28534517, 30283082		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	28481899		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	21220648		★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	31760859	Inhibit	★☆☆☆☆ Found in Text Mining only
Aneurysm	Aneurysm	Pubtator	29929532	Stimulate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	22266188, 23846574, 25336691, 26876211, 28534517, 30283082		★☆☆☆☆ Found in Text Mining only
Aortic Dissection	Aortic dissection	Pubtator	22228989	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic valve stenosis	Pubtator	26742884	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	29867136		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	15970583	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	29867136		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	28459201, 30629950, 31176992		★☆☆☆☆ Found in Text Mining only
Brain Injuries Diffuse	Brain injuries	Pubtator	40063067	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	31888563	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11054714, 17671699, 19020750, 19036156, 28332606, 29948401, 31401293, 9537227		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19036156, 28332606, 32160387	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	12927043, 18827816, 31760859	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	28481899		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34664394	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	28459201, 30629950, 31176992		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	19020750, 25961303, 29549325		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	21637745	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	27319973	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	29088800		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	36863704	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	12118103		★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	29867136		★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	31715293	Stimulate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	32705211	Associate	★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	26709788, 29427759		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	22814255		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	22711178, 28481899	Stimulate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	33493133	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	12366811, 17671699, 19020750		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	12366811		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22711178, 33422939	Associate	★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	31417643		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	23480731, 31235849		★☆☆☆☆ Found in Text Mining only
Connective Tissue Diseases	Connective Tissue Disease	BEFREE	29760442		★☆☆☆☆ Found in Text Mining only
Cornea plana	Cornea Plana	BEFREE	17558846		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	11890723		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	BEFREE	26966275, 29068691		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	28314539, 28529073, 28891346, 30803355, 31456498, 31848044		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	30700002, 31715293		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	32453760	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	18092746	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	33568476, 33887734, 34557161	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	32964764	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	39256753	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	19330863	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	23007134		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	23007134, 29427759		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	CTD_human_DG	26396155		★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	BEFREE	25304290		★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	16565384	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	26230845, 38286983	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	15665100		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	23480731, 31235849		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	36254001	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	26709788	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	12927043	Associate	★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	12118103, 30562113		★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	40443657	Associate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	32293066	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	32873329, 34516336	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral disc disease	Intervertebral disc disease	Pubtator	34516336	Associate	★☆☆☆☆ Found in Text Mining only
Isovaleryl-CoA dehydrogenase deficiency	Isovaleryl-CoA dehydrogenase deficiency	BEFREE	29451946, 30146268		★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	23727491	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	18327085		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	CTD_human_DG	26396155		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis	Liver Cirrhosis	BEFREE	26709788, 29427759		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung diseases	Lung Diseases	BEFREE	28314539, 29451946		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	29549325	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	31760859	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	21885486		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	35967373	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	31888563	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	28534517		★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	30404605, 35186229	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11054714, 17671699, 19020750, 19036156, 28332606, 29948401, 31401293		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	19020750, 25961303, 29549325		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	29088800		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	11857496, 17671699, 19020750, 22266188, 25336691, 30283082		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28542982, 29098025		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	28459201, 30629950, 31176992		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17671699, 18848571, 19020750, 26876211, 28459201, 28542982, 30283082, 30629950		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	22814255		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	11054714, 19036156, 9537227		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	29581064		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	15149859, 18848571, 23438179, 24098450, 28794454		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	15149859, 17050378		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	17050378, 24098450	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	30409703		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Facioscapulohumeral	Facioscapulohumeral Muscular Dystrophy	BEFREE	12868502		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Facioscapulohumeral	Facioscapulohumeral Muscular Dystrophy	CTD_human_DG	12868502		★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	Pubtator	15592176, 16902402, 31776299	Associate	★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	BEFREE	19616852, 20010793, 29760442		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	11425208		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11857496, 15149859, 15258999, 15753980, 17671699, 19020750, 21224353, 23438179, 24098450, 25304290, 25336691, 25961303, 28481899, 28794454, 29948401, 30283082, 30629950, 30711828, 9537227		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	26230845, 31861249, 37947594	Associate	★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	30409703		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	23007134		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	19330863, 32293066	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	30409703		★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	19036156		★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral Submucous Fibrosis	BEFREE	28980718		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	31715293	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	30700002		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	39383820	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	18093185, 21421073		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	LHGDN	18093185		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	18093185	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	29088800		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	24804215, 32319226, 35874760	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	11857496, 17671699, 19020750, 22266188, 25336691, 30283082		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	17671699, 22266188, 23846574, 25336691, 26876211, 28534517, 30283082		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	17671699		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	19843670, 22316387	Associate	★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic Organ Prolapse	BEFREE	19251763, 29630675		★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic organ prolapse	Pubtator	29630675	Associate	★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	36686480	Associate	★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	BEFREE	25961303		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	28789706		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	28789706	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	37108678	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	26038391		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	26038391	Stimulate	★☆☆☆☆ Found in Text Mining only
Rheumatic Heart Disease	Rheumatic Heart Disease	BEFREE	28121998		★☆☆☆☆ Found in Text Mining only
Rheumatic Heart Disease	Rheumatic heart disease	Pubtator	28121998	Associate	★☆☆☆☆ Found in Text Mining only
Severe myopia	Myopia	BEFREE	15592176, 16902402, 17117407, 19616852, 19643966, 20010793, 21743019, 22809227, 23145541, 24061151, 24516061, 24927138, 24956166, 29062769		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	19020750		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	19020750		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28542982, 29098025		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	18827816	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	38129820	Stimulate	★☆☆☆☆ Found in Text Mining only
Tetralogy of Fallot	Tetralogy of fallot	Pubtator	23571024	Inhibit	★☆☆☆☆ Found in Text Mining only
Tetralogy of Fallot	Tetralogy of fallot	Pubtator	32805183	Stimulate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	28459201, 33035117	Associate	★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	28459201		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasm	Uterine cervix neoplasm	LHGDN	11956587		★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Ventricular remodeling	Pubtator	23571024	Associate	★☆☆☆☆ Found in Text Mining only