Gene Gene information from NCBI Gene database.
Entrez ID 4060
Gene name Lumican
Gene symbol LUM
Synonyms (NCBI Gene)
LDCSLRR2D
Chromosome 12
Chromosome location 12q21.33
Summary This gene encodes a member of the small leucine-rich proteoglycan (SLRP) family that includes decorin, biglycan, fibromodulin, keratocan, epiphycan, and osteoglycin. In these bifunctional molecules, the protein moiety binds collagen fibrils and the highly
miRNA miRNA information provided by mirtarbase database.
101
miRTarBase ID miRNA Experiments Reference
MIRT735118 hsa-miR-450b-5p qRT-PCR 31776299
MIRT1122429 hsa-miR-4282 CLIP-seq
MIRT1122430 hsa-miR-4330 CLIP-seq
MIRT1122431 hsa-miR-4760-3p CLIP-seq
MIRT1122432 hsa-miR-490-5p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
28
GO ID Ontology Definition Evidence Reference
GO:0005201 Function Extracellular matrix structural constituent NAS 10892350
GO:0005515 Function Protein binding IPI 25304424, 32814053
GO:0005518 Function Collagen binding IBA
GO:0005518 Function Collagen binding IDA 10892350
GO:0005576 Component Extracellular region HDA 27068509
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
600616 6724 ENSG00000139329
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P51884
Protein name Lumican (Keratan sulfate proteoglycan lumican) (KSPG lumican)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01462 LRRNT 36 66 Leucine rich repeat N-terminal domain Family
PF13855 LRR_8 67 102 Leucine rich repeat Repeat
PF13855 LRR_8 136 171 Leucine rich repeat Repeat
PF13516 LRR_6 182 197 Leucine Rich repeat Repeat
PF13855 LRR_8 205 266 Leucine rich repeat Repeat
Tissue specificity TISSUE SPECIFICITY: Cornea and other tissues.
Sequence
MSLSAFTLFLALIGGTSGQYYDYDFPLSIYGQSSPNCAPECNCPESYPSAMYCDELKLKS
VPMVPP
GIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGRVFSKLKQLKK
LHINHNNLTESVGPLPKSLEDLQLTHNKITKLGSFEGLVNLTFIHLQHNRLKEDAVSAAF
KGLKSLEYLDLSFNQIARLPSGLPVSLLTLYLDNNKISNIPDEYFKRFNALQYLRLSHNE
LADSGIPGNSFNVSSLVELDLSYNKL
KNIPTVNENLENYYLEVNQLEKFDIKSFCKILGP
LSYSKIKHLRLDGNRISETSLPPDMYECLRVANEVTLN
Sequence length 338
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Proteoglycans in cancer   Keratan sulfate biosynthesis
Keratan sulfate degradation
Integrin cell surface interactions
Defective CHST6 causes MCDC1
Defective ST3GAL3 causes MCT12 and EIEE15
Defective B4GALT1 causes B4GALT1-CDG (CDG-2d)
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
12
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
CAROTID ARTERY DISEASES Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adenocarcinoma Adenocarcinoma BEFREE 19020750, 25961303
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma Adenocarcinoma LHGDN 19020750
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of colon Adenocarcinoma Of Colon BEFREE 22814255
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of lung (disorder) Lung adenocarcinoma BEFREE 19020750, 25961303
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of pancreas Pancreatic adenocarcinoma BEFREE 19843670, 28534517, 30283082
★☆☆☆☆
Found in Text Mining only
Adenoma Adenoma BEFREE 28481899
★☆☆☆☆
Found in Text Mining only
Amyotrophic Lateral Sclerosis Amyotrophic Lateral Sclerosis BEFREE 21220648
★☆☆☆☆
Found in Text Mining only
Aneuploidy Aneuploidy Pubtator 31760859 Inhibit
★☆☆☆☆
Found in Text Mining only
Aneurysm Aneurysm Pubtator 29929532 Stimulate
★☆☆☆☆
Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA Syndromic microphthalmia BEFREE 22266188, 23846574, 25336691, 26876211, 28534517, 30283082
★☆☆☆☆
Found in Text Mining only