LTF (lactotransferrin)

Gene

• Entrez ID: 4057
• Gene name: Lactotransferrin
• Gene symbol: LTF
• Synonyms (NCBI Gene): GIG12, HEL110, HLF2, LF
• Chromosome: 3
• Chromosome location: 3p21.31
• Summary: This gene is a member of the transferrin family of genes and its protein product is found in the secondary granules of neutrophils. The protein is a major iron-binding protein in milk and body secretions with an antimicrobial activity, making it an import

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT437811	hsa-miR-214-3p	Luciferase reporter assay	23479198
MIRT437811	hsa-miR-214-3p	Luciferase reporter assay	23479198
MIRT650642	hsa-miR-4778-5p	HITS-CLIP	23824327
MIRT650641	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT650640	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT650639	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT650638	hsa-miR-6728-3p	HITS-CLIP	23824327
MIRT650637	hsa-miR-412-3p	HITS-CLIP	23824327
MIRT650635	hsa-miR-6754-3p	HITS-CLIP	23824327
MIRT650636	hsa-miR-6837-3p	HITS-CLIP	23824327
MIRT650634	hsa-miR-942-5p	HITS-CLIP	23824327
MIRT650633	hsa-miR-6740-3p	HITS-CLIP	23824327
MIRT650632	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT650631	hsa-miR-3191-5p	HITS-CLIP	23824327
MIRT650630	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT650629	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT650628	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT650627	hsa-miR-4743-3p	HITS-CLIP	23824327
MIRT650626	hsa-miR-3664-5p	HITS-CLIP	23824327
MIRT650642	hsa-miR-4778-5p	HITS-CLIP	23824327
MIRT650641	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT650640	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT650639	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT650638	hsa-miR-6728-3p	HITS-CLIP	23824327
MIRT650637	hsa-miR-412-3p	HITS-CLIP	23824327
MIRT650635	hsa-miR-6754-3p	HITS-CLIP	23824327
MIRT650636	hsa-miR-6837-3p	HITS-CLIP	23824327
MIRT650634	hsa-miR-942-5p	HITS-CLIP	23824327
MIRT650633	hsa-miR-6740-3p	HITS-CLIP	23824327
MIRT650632	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT650631	hsa-miR-3191-5p	HITS-CLIP	23824327
MIRT650630	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT650629	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT650628	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT650627	hsa-miR-4743-3p	HITS-CLIP	23824327
MIRT650626	hsa-miR-3664-5p	HITS-CLIP	23824327

Transcription factors

Transcription factor	Regulation	Reference
CEBPE	Unknown	12522000
SP1	Unknown	10845904

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001503	Process	Ossification	IEA
GO:0001530	Function	Lipopolysaccharide binding	IDA	9596699
GO:0001530	Function	Lipopolysaccharide binding	IMP	15155221
GO:0001817	Process	Regulation of cytokine production	IDA	20345905
GO:0001817	Process	Regulation of cytokine production	IEA
GO:0002227	Process	Innate immune response in mucosa	IDA	12037568
GO:0002376	Process	Immune system process	IEA
GO:0003677	Function	DNA binding	IEA
GO:0004252	Function	Serine-type endopeptidase activity	IEA
GO:0004252	Function	Serine-type endopeptidase activity	TAS	9770539
GO:0004869	Function	Cysteine-type endopeptidase inhibitor activity	IDA	12788072
GO:0005506	Function	Iron ion binding	IDA	12037568
GO:0005506	Function	Iron ion binding	IEA
GO:0005515	Function	Protein binding	IPI	1544444, 9223490, 12522210, 17567961, 25193851, 27616280
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	16502470, 22664934, 23580065
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	12788072, 17567961, 18714013
GO:0005615	Component	Extracellular space	IEA
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	IMP	25193851
GO:0005769	Component	Early endosome	IBA
GO:0005886	Component	Plasma membrane	IBA
GO:0006508	Process	Proteolysis	IEA
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006826	Process	Iron ion transport	IBA
GO:0006826	Process	Iron ion transport	IEA
GO:0006959	Process	Humoral immune response	TAS	9770539
GO:0008201	Function	Heparin binding	IDA	11907569
GO:0008201	Function	Heparin binding	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	IEA
GO:0009986	Component	Cell surface	IDA	17567961
GO:0016787	Function	Hydrolase activity	IEA
GO:0019731	Process	Antibacterial humoral response	IBA
GO:0019731	Process	Antibacterial humoral response	IDA	1599934, 18714013
GO:0019731	Process	Antibacterial humoral response	IEA
GO:0019732	Process	Antifungal humoral response	IDA	11083624
GO:0019732	Process	Antifungal humoral response	IEA
GO:0030141	Component	Secretory granule	IDA	11907569
GO:0031640	Process	Killing of cells of another organism	IDA	9727055
GO:0031640	Process	Killing of cells of another organism	IMP	15155221
GO:0031665	Process	Negative regulation of lipopolysaccharide-mediated signaling pathway	IDA	20345905
GO:0032680	Process	Regulation of tumor necrosis factor production	IDA	20345905
GO:0032780	Process	Negative regulation of ATP-dependent activity	IMP	25193851
GO:0032991	Component	Protein-containing complex	IDA	17567961
GO:0033690	Process	Positive regulation of osteoblast proliferation	IDA	15166119
GO:0034145	Process	Positive regulation of toll-like receptor 4 signaling pathway	IMP	20345905
GO:0035580	Component	Specific granule lumen	TAS
GO:0042581	Component	Specific granule	IDA	2981589
GO:0042742	Process	Defense response to bacterium	IEA
GO:0043066	Process	Negative regulation of apoptotic process	ISS
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IDA	20345905
GO:0043539	Function	Protein serine/threonine kinase activator activity	IDA	20345905
GO:0044793	Process	Host-mediated suppression of viral proces	IMP	12522210
GO:0045071	Process	Negative regulation of viral genome replication	IMP	25193851
GO:0045087	Process	Innate immune response	IMP	9596699
GO:0045669	Process	Positive regulation of osteoblast differentiation	IDA	15166119
GO:0045837	Process	Negative regulation of membrane potential	IMP	9596699
GO:0046872	Function	Metal ion binding	IEA
GO:0048525	Process	Negative regulation of viral process	IMP	25193851
GO:0050829	Process	Defense response to Gram-negative bacterium	IMP	9596699, 15155221
GO:0050830	Process	Defense response to Gram-positive bacterium	IMP	9596699
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IDA	20345905
GO:0051838	Process	Cytolysis by host of symbiont cells	IMP	9596699
GO:0055037	Component	Recycling endosome	IBA
GO:0060349	Process	Bone morphogenesis	IDA	15166119
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IMP	15155221
GO:0070062	Component	Extracellular exosome	HDA	19199708, 23533145
GO:0071902	Process	Positive regulation of protein serine/threonine kinase activity	IDA	20345905
GO:0097013	Component	Phagocytic vesicle lumen	TAS
GO:0140912	Function	Membrane destabilizing activity	IMP	15155221
GO:1900159	Process	Positive regulation of bone mineralization involved in bone maturation	ISS
GO:1900229	Process	Negative regulation of single-species biofilm formation in or on host organism	IDA	12037568
GO:1902732	Process	Positive regulation of chondrocyte proliferation	IDA	15166119
GO:1904724	Component	Tertiary granule lumen	TAS
GO:2000308	Process	Negative regulation of tumor necrosis factor (ligand) superfamily member 11 production	ISS
GO:2001205	Process	Negative regulation of osteoclast development	ISS

Other IDs

• MIM: 150210
• HGNC: 6720
• e!Ensembl: ENSG00000012223

Protein

• UniProt ID: P02788
• Protein name: Lactotransferrin (Lactoferrin) (EC 3.4.21.-) (Growth-inhibiting protein 12) (Talalactoferrin) [Cleaved into: Lactoferricin-H (Lfcin-H); Kaliocin-1; Lactoferroxin-A; Lactoferroxin-B; Lactoferroxin-C]
• Protein function: Transferrins are iron binding transport proteins which can bind two Fe(3+) ions in association with the binding of an anion, usually bicarbonate. ; [Lactotransferrin]: Major iron-binding and multifunctiona
• PDB: 1B0L, 1BKA, 1CB6, 1DSN, 1EH3, 1FCK, 1H43, 1H44, 1H45, 1HSE, 1L5T, 1LCF, 1LCT, 1LFG, 1LFH, 1LFI, 1LGB, 1N76, 1SQY, 1U62, 1VFD, 1VFE, 1XV4, 1XV7, 1Z6V, 1Z6W, 2BJJ, 2DP4, 2GMC, 2GMD, 2HD4, 2PMS, 7JRD, 7N88
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00405	Transferrin	25 → 352	Transferrin	Domain
  PF00405	Transferrin	364 → 695	Transferrin	Domain

• Tissue specificity: TISSUE SPECIFICITY: High levels are found in saliva and tears, intermediate levels in serum and plasma, and low levels in urine. In kidney, detected in the distal collecting tubules in the medulla but not in the cortical region or in blood vessels. Detect
• Sequence:

  MKLVFLVLLFLGALGLCLAGRRRSVQWCAVSQPEATKCFQWQRNMRKVRGPPVSCIKRDS
  PIQCIQAIAENRADAVTLDGGFIYEAGLAPYKLRPVAAEVYGTERQPRTHYYAVAVVKKG
  GSFQLNELQGLKSCHTGLRRTAGWNVPIGTLRPFLNWTGPPEPIEAAVARFFSASCVPGA
  DKGQFPNLCRLCAGTGENKCAFSSQEPYFSYSGAFKCLRDGAGDVAFIRESTVFEDLSDE
  AERDEYELLCPDNTRKPVDKFKDCHLARVPSHAVVARSVNGKEDAIWNLLRQAQEKFGKD
  KSPKFQLFGSPSGQKDLLFKDSAIGFSRVPPRIDSGLYLGSGYFTAIQNLRKSEEEVAAR
  RARVVWCAVGEQELRKCNQWSGLSEGSVTCSSASTTEDCIALVLKGEADAMSLDGGYVYT
  AGKCGLVPVLAENYKSQQSSDPDPNCVDRPVEGYLAVAVVRRSDTSLTWNSVKGKKSCHT
  AVDRTAGWNIPMGLLFNQTGSCKFDEYFSQSCAPGSDPRSNLCALCIGDEQGENKCVPNS
  NERYYGYTGAFRCLAENAGDVAFVKDVTVLQNTDGNNNEAWAKDLKLADFALLCLDGKRK
  PVTEARSCHLAMAPNHAVVSRMDKVERLKQVLLHQQAKFGRNGSDCPDKFCLFQSETKNL
  LFNDNTECLARLHGKTTYEKYLGPQYVAGITNLKKCSTSPLLEACEFLRK

• Sequence length: 710

Pathways

Reactome:

Mtb iron assimilation by chelation
Neutrophil degranulation
Metal sequestration by antimicrobial proteins
Antimicrobial peptides
Amyloid fiber formation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ARTHROPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC LEFT-SIDED ULCERATIVE COLITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic lymphocytic leukemia/small lymphocytic lymphoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLITIS, ULCERATIVE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIARRHEA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSENTERY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENTEROCOLITIS, NECROTIZING	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial pancreatic carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROINTESTINAL HEMORRHAGE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTENSION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NECROTIZING ENTEROCOLITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOPOROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
AA amyloidosis	AA amyloidosis	BEFREE	23884333		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	1586744		★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	BEFREE	18973542		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	19348738	Stimulate	★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	LHGDN	15297857		★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	35571618	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	29410669	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthropathy	Arthropathy	CTD_human_DG	16640825		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	33878997	Associate	★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	34928497	Associate	★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	35654816	Associate	★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	CTD_human_DG	16640825		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11908638, 1338274, 1674448, 22309278, 28961215		★☆☆☆☆ Found in Text Mining only
Breast Diseases	Breast Diseases	BEFREE	1338274		★☆☆☆☆ Found in Text Mining only
Cap Myopathy	Cap myopathy	Pubtator	17568188	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	25370482		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	16152584		★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	37056929	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	21937479		★☆☆☆☆ Found in Text Mining only
Choroid Plexus Papilloma	Choroid Plexus Papilloma	BEFREE	30360131		★☆☆☆☆ Found in Text Mining only
Chromosome 2q32-Q33 Deletion Syndrome	2q32-q33 Deletion Syndrome	BEFREE	27758034		★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	36677706	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	28485077		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	28485077	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	25993694	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	28169560		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	CTD_human_DG	12079509		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital neutropenia	Congenital Neutropenia	BEFREE	12554799		★☆☆☆☆ Found in Text Mining only
Corneal dystrophy, Lattice type 3	Corneal Dystrophy	BEFREE	9873069		★☆☆☆☆ Found in Text Mining only
Coronary Stenosis	Coronary Stenosis	BEFREE	22406253		★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	18216739		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	30335469		★☆☆☆☆ Found in Text Mining only
Dental Caries	Dental caries	Pubtator	20485928, 25531160	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	28846026		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	32075680	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	23333090		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	36092962, 36401196, 37986381	Associate	★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry eye syndrome	Pubtator	36677706	Associate	★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	18156281		★☆☆☆☆ Found in Text Mining only
ECTRODACTYLY, ECTODERMAL DYSPLASIA, AND CLEFT LIP/PALATE SYNDROME 1	Ectrodactyly	BEFREE	14522886		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	28846026		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	10572182, 1939212, 7762430, 9397949		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	29693365	Associate	★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	CTD_human_DG	21063030		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	16644090		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	CTD_human_DG	21063030		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Enteritis	Enteritis	LHGDN	12438385		★☆☆☆☆ Found in Text Mining only
Eye Diseases	Eye disease	Pubtator	36490268	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	29975946		★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	37108298	Inhibit	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	36153549	Associate	★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	34522174	Associate	★☆☆☆☆ Found in Text Mining only
Hearing Loss	Hearing loss	Pubtator	34758154	Associate	★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia	BEFREE	26727350		★☆☆☆☆ Found in Text Mining only
Hemophilia, NOS	Hemophilia	BEFREE	26727350		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	29774543	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertension	Hypertension	Pubtator	29774543	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	CTD_human_DG	24587916		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	21309737	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	30689765	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	21678402		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	35613904	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral disc disease	Intervertebral disc disease	Pubtator	35613904	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	22944598	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	30892034		★☆☆☆☆ Found in Text Mining only
Keratitis	Keratitis	LHGDN	18022620		★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	23727491, 36293206	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	27140517		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	11908638		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	36212177	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	CTD_human_DG	12079509		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	LHGDN	16152584		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	40025620	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25286756	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11908638, 1674448, 22309278, 28961215		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	CTD_human_DG	12079509		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	16152584		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	21937479		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	17568188		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	CTD_human_DG	16640825		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17568188, 25406879		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	CTD_human_DG	12079509		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	28169560		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15543612		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	1733438		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	29069749, 30682171		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	32957486	Associate	★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis IV	Mucopolysaccharidosis	Pubtator	33379360	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	1586744		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	23709377, 33506054	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	17476971, 19129950, 22011934, 23069661, 23479198, 25286756		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	19129950, 33564686	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	25286756	Inhibit	★☆☆☆☆ Found in Text Mining only
Necrotizing Enterocolitis	Necrotizing Enterocolitis	CTD_human_DG	16640825		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	10610706, 16432833, 21400573, 23069661, 23479198, 25286756, 25370482, 28169560, 31286769		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	CTD_human_DG	16640825		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	32786404	Associate	★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 2	Neurofibromatosis	Pubtator	32366326	Associate	★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	29975946		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	16152584		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	25394788	Stimulate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	32075680	Associate	★☆☆☆☆ Found in Text Mining only
Oral Ulcer	Oral Ulcer	GWASCAT_DG	30837455		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	32925767	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	CTD_human_DG	16648989, 16936800		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis	Osteoporosis	LHGDN	16936800		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis, Age-Related	Osteoporosis	CTD_human_DG	16648989, 16936800		★☆☆☆☆ Found in Text Mining only
Osteoporosis, Senile	Osteoporosis	CTD_human_DG	16648989, 16936800		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	21937479		★☆☆☆☆ Found in Text Mining only
Ovarian Cysts	Ovarian Cysts	LHGDN	16644090		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	21937479		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	21937479	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	20082992		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	32786404	Stimulate	★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	21947848, 28485077		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	LHGDN	17030385		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	18973542, 28485077		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	28485077	Associate	★☆☆☆☆ Found in Text Mining only
Post-Traumatic Osteoporosis	Osteoporosis	CTD_human_DG	16648989, 16936800		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	17568188		★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasia	Prostatic intraepithelial neoplasia	Pubtator	31499027	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	17568188, 31499027	Inhibit	★☆☆☆☆ Found in Text Mining only
Reactive systemic amyloidosis	Reactive Systemic Amyloidosis	BEFREE	23884333		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	30667541, 31028944		★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	16432833		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	34045583	Associate	★☆☆☆☆ Found in Text Mining only
Specific granule deficiency	Specific Granule Deficiency	BEFREE	2536400, 2673450		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	28358840		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	36360322	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	29761938		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	29975946		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	34522174	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	37457741	Stimulate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	CTD_human_DG	16640825		★★☆☆☆ Found in Text Mining + Unknown/Other Associations