LSP1 (lymphocyte specific protein 1)

Gene

• Entrez ID: 4046
• Gene name: Lymphocyte specific protein 1
• Gene symbol: LSP1
• Synonyms (NCBI Gene): WP34, pp52
• Chromosome: 11
• Chromosome location: 11p15.5
• Summary: This gene encodes an intracellular F-actin binding protein. The protein is expressed in lymphocytes, neutrophils, macrophages, and endothelium and may regulate neutrophil motility, adhesion to fibrinogen matrix proteins, and transendothelial migration. Al

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018132	hsa-miR-335-5p	Microarray	18185580
MIRT437982	hsa-miR-196a-5p	Luciferase reporter assay	24681820
MIRT437982	hsa-miR-196a-5p	Luciferase reporter assay	24681820
MIRT489821	hsa-miR-6858-3p	PAR-CLIP	20371350
MIRT489819	hsa-miR-4676-5p	PAR-CLIP	20371350
MIRT489818	hsa-miR-575	PAR-CLIP	20371350
MIRT489817	hsa-miR-3918	PAR-CLIP	20371350
MIRT489816	hsa-miR-4685-5p	PAR-CLIP	20371350
MIRT489815	hsa-miR-6837-5p	PAR-CLIP	20371350
MIRT489814	hsa-miR-3656	PAR-CLIP	20371350
MIRT489813	hsa-miR-6781-5p	PAR-CLIP	20371350
MIRT489812	hsa-miR-328-5p	PAR-CLIP	20371350
MIRT489811	hsa-miR-6885-5p	PAR-CLIP	20371350
MIRT489810	hsa-miR-4662a-5p	PAR-CLIP	20371350
MIRT489821	hsa-miR-6858-3p	PAR-CLIP	23592263
MIRT489819	hsa-miR-4676-5p	PAR-CLIP	23592263
MIRT489818	hsa-miR-575	PAR-CLIP	23592263
MIRT489817	hsa-miR-3918	PAR-CLIP	23592263
MIRT489816	hsa-miR-4685-5p	PAR-CLIP	23592263
MIRT489815	hsa-miR-6837-5p	PAR-CLIP	23592263
MIRT489814	hsa-miR-3656	PAR-CLIP	23592263
MIRT489813	hsa-miR-6781-5p	PAR-CLIP	23592263
MIRT489812	hsa-miR-328-5p	PAR-CLIP	23592263
MIRT489811	hsa-miR-6885-5p	PAR-CLIP	23592263
MIRT489810	hsa-miR-4662a-5p	PAR-CLIP	23592263
MIRT489812	hsa-miR-328-5p	PAR-CLIP	26701625
MIRT489814	hsa-miR-3656	PAR-CLIP	26701625
MIRT489817	hsa-miR-3918	PAR-CLIP	26701625
MIRT489810	hsa-miR-4662a-5p	PAR-CLIP	26701625
MIRT489819	hsa-miR-4676-5p	PAR-CLIP	26701625
MIRT489816	hsa-miR-4685-5p	PAR-CLIP	26701625
MIRT489818	hsa-miR-575	PAR-CLIP	26701625
MIRT489813	hsa-miR-6781-5p	PAR-CLIP	26701625
MIRT489815	hsa-miR-6837-5p	PAR-CLIP	26701625
MIRT489821	hsa-miR-6858-3p	PAR-CLIP	26701625
MIRT489811	hsa-miR-6885-5p	PAR-CLIP	26701625
MIRT489821	hsa-miR-6858-3p	PAR-CLIP	20371350
MIRT489819	hsa-miR-4676-5p	PAR-CLIP	20371350
MIRT489818	hsa-miR-575	PAR-CLIP	20371350
MIRT489817	hsa-miR-3918	PAR-CLIP	20371350
MIRT489816	hsa-miR-4685-5p	PAR-CLIP	20371350
MIRT489815	hsa-miR-6837-5p	PAR-CLIP	20371350
MIRT489814	hsa-miR-3656	PAR-CLIP	20371350
MIRT489813	hsa-miR-6781-5p	PAR-CLIP	20371350
MIRT489812	hsa-miR-328-5p	PAR-CLIP	20371350
MIRT489811	hsa-miR-6885-5p	PAR-CLIP	20371350
MIRT489810	hsa-miR-4662a-5p	PAR-CLIP	20371350
MIRT489821	hsa-miR-6858-3p	PAR-CLIP	23592263
MIRT489819	hsa-miR-4676-5p	PAR-CLIP	23592263
MIRT489818	hsa-miR-575	PAR-CLIP	23592263
MIRT489817	hsa-miR-3918	PAR-CLIP	23592263
MIRT489816	hsa-miR-4685-5p	PAR-CLIP	23592263
MIRT489815	hsa-miR-6837-5p	PAR-CLIP	23592263
MIRT489814	hsa-miR-3656	PAR-CLIP	23592263
MIRT489813	hsa-miR-6781-5p	PAR-CLIP	23592263
MIRT489812	hsa-miR-328-5p	PAR-CLIP	23592263
MIRT489811	hsa-miR-6885-5p	PAR-CLIP	23592263
MIRT489810	hsa-miR-4662a-5p	PAR-CLIP	23592263
MIRT1121960	hsa-miR-1231	CLIP-seq
MIRT1121961	hsa-miR-149	CLIP-seq
MIRT1121962	hsa-miR-3064-5p	CLIP-seq
MIRT1121963	hsa-miR-331-3p	CLIP-seq
MIRT1121964	hsa-miR-3652	CLIP-seq
MIRT1121965	hsa-miR-4292	CLIP-seq
MIRT1121966	hsa-miR-4430	CLIP-seq
MIRT1121967	hsa-miR-4505	CLIP-seq
MIRT1121968	hsa-miR-4794	CLIP-seq
MIRT1121969	hsa-miR-4487	CLIP-seq
MIRT1121970	hsa-miR-802	CLIP-seq
MIRT2442332	hsa-miR-1238	CLIP-seq
MIRT2442333	hsa-miR-3124-3p	CLIP-seq
MIRT2442334	hsa-miR-361-3p	CLIP-seq
MIRT2442335	hsa-miR-383	CLIP-seq
MIRT2442336	hsa-miR-4433	CLIP-seq
MIRT2442337	hsa-miR-4459	CLIP-seq
MIRT2442338	hsa-miR-4691-5p	CLIP-seq
MIRT2442339	hsa-miR-4768-3p	CLIP-seq
MIRT2442340	hsa-miR-4772-5p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
SP1	Unknown	9257843

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003779	Function	Actin binding	IEA
GO:0003779	Function	Actin binding	TAS	8274738
GO:0005515	Function	Protein binding	IPI	35156780
GO:0005886	Component	Plasma membrane	IEA
GO:0006935	Process	Chemotaxis	IEA
GO:0006952	Process	Defense response	IEA
GO:0006968	Process	Cellular defense response	TAS	2174784
GO:0007165	Process	Signal transduction	IEA
GO:0015629	Component	Actin cytoskeleton	TAS	8274738
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0098761	Process	Cellular response to interleukin-7	IEA

Other IDs

• MIM: 153432
• HGNC: 6707
• e!Ensembl: ENSG00000130592

Protein

• UniProt ID: P33241
• Protein name: Lymphocyte-specific protein 1 (47 kDa actin-binding protein) (52 kDa phosphoprotein) (pp52) (Lymphocyte-specific antigen WP34)
• Protein function: May play a role in mediating neutrophil activation and chemotaxis.
• PDB: 3BH8, 4NO0, 4NO2
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02029	Caldesmon	159 → 317	Caldesmon	Disordered

• Tissue specificity: TISSUE SPECIFICITY: Activated T-lymphocytes.
• Sequence:

  MAEASSDPGAEEREELLGPTAQWSVEDEEEAVHEQCQHERDRQLQAQDEEGGGHVPERPK
  QEMLLSLKPSEAPELDEDEGFGDWSQRPEQRQQHEGAQGALDSGEPPQCRSPEGEQEDRP
  GLHAYEKEDSDEVHLEELSLSKEGPGPEDTVQDNLGAAGAEEEQEEHQKCQQPRTPSPLV
  LEGTIEQSSPPLSPTTKLIDRTESLNRSIEKSNSVKKSQPDLPISKIDQWLEQYTQAIET
  AGRTPKLARQASIELPSMAVASTKSRWETGEVQAQSAAKTPSCKDIVAGDMSKKSLWEQK
  GGSKTSSTIKSTPSGKRYKFVATGHGKYEKVLVEGGPAP

• Sequence length: 339

Pathways

KEGG:

C-type lectin receptor signaling pathway
Tuberculosis

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATRIAL FIBRILLATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CALCINOSIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC LEFT-SIDED ULCERATIVE COLITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLITIS, ULCERATIVE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESSENTIAL HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART VALVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART VALVE DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART VALVE PROLAPSE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTRACEREBRAL HEMORRHAGE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALIGNANT URINARY SYSTEM NEOPLASM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POTASSIUM DEFICIENCY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY ALDOSTERONISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	19843670		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	34691030	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	7884850		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	GWASCAT_DG	17529967, 23535729, 25751625, 27117709, 29059683		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	17529967, 20453838		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	18437204, 19656774, 21127985, 21996731, 22454379, 22532573, 23893088, 24681604, 25611573, 26191300, 26911390, 27432265, 27590509, 28757652		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	17529967, 18437204, 18612136, 18973230, 19094228, 19656774, 20453838, 20484103, 20605201, 20699374, 21118973, 21194473, 21596841, 21791674, 22045194, 22053997, 22357627, 22454379, 22532573, 22867275, 22910930, 23544014, 23756864, 23893088, 25862352, 25881232, 26191300, 26911390, 27165221, 30078824, 32366738	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	22326833, 29927686, 37889536	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	24681604		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	GWASCAT_DG	30595370		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32321427	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	32003759	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	32003759	Associate	★☆☆☆☆ Found in Text Mining only
Heart valve disease	Cardiac valvular disease	CTD_human_DG	21335463		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hodgkin Disease	Hodgkin disease	Pubtator	10233704, 12588355	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	GWASCAT_DG	30487518		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	38511641	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	29956722, 31015209, 38186215, 38511641, 39952006	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29927686, 30126548		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	12588355	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	24598796		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	17529967, 20453838		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	GWASDB_DG	17529967, 23535729		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	18437204, 19656774, 21127985, 21996731, 22454379, 22532573, 23893088, 24681604, 25611573, 26191300, 26911390, 27432265, 27590509, 28757652		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	24681604		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	17529967, 20453838		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	17529967, 20453838		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	17529967, 20453838		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	9616178		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	9616178	Inhibit	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	GWASDB_DG	20512145		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25611573, 27165221		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	34925639	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21499820	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	26554018		★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	BEFREE	28987360		★☆☆☆☆ Found in Text Mining only
Tumoral calcinosis	Tumoral Calcinosis	CTD_human_DG	21335463		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	CTD_human_DG	21297633		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	24163127	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	39206965	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	40038352	Stimulate	★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	34925639	Associate	★☆☆☆☆ Found in Text Mining only