Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	404550
Gene name	Chromosome 16 open reading frame 74
Gene symbol	C16orf74
Synonyms (NCBI Gene)	ASRACLMBMICT1
Chromosome	16
Chromosome location	16q24.1

101

Show/Hide all (101)

miRTarBase ID	miRNA	Experiments	Reference
MIRT503240	hsa-miR-6165	PAR-CLIP	20371350
MIRT503239	hsa-miR-6858-3p	PAR-CLIP	20371350
MIRT503238	hsa-miR-4722-5p	PAR-CLIP	20371350
MIRT503237	hsa-miR-3194-5p	PAR-CLIP	20371350
MIRT503236	hsa-miR-505-5p	PAR-CLIP	20371350
MIRT503240	hsa-miR-6165	PAR-CLIP	20371350
MIRT503239	hsa-miR-6858-3p	PAR-CLIP	20371350
MIRT503238	hsa-miR-4722-5p	PAR-CLIP	20371350
MIRT503237	hsa-miR-3194-5p	PAR-CLIP	20371350
MIRT503236	hsa-miR-505-5p	PAR-CLIP	20371350
MIRT503240	hsa-miR-6165	PAR-CLIP	23446348
MIRT503239	hsa-miR-6858-3p	PAR-CLIP	23446348
MIRT503238	hsa-miR-4722-5p	PAR-CLIP	23446348
MIRT503237	hsa-miR-3194-5p	PAR-CLIP	23446348
MIRT503236	hsa-miR-505-5p	PAR-CLIP	23446348
MIRT503240	hsa-miR-6165	PAR-CLIP	23446348
MIRT503239	hsa-miR-6858-3p	PAR-CLIP	23446348
MIRT503238	hsa-miR-4722-5p	PAR-CLIP	23446348
MIRT503237	hsa-miR-3194-5p	PAR-CLIP	23446348
MIRT503236	hsa-miR-505-5p	PAR-CLIP	23446348
MIRT503240	hsa-miR-6165	PAR-CLIP	20371350
MIRT503239	hsa-miR-6858-3p	PAR-CLIP	20371350
MIRT503238	hsa-miR-4722-5p	PAR-CLIP	20371350
MIRT503237	hsa-miR-3194-5p	PAR-CLIP	20371350
MIRT503236	hsa-miR-505-5p	PAR-CLIP	20371350
MIRT503240	hsa-miR-6165	PAR-CLIP	20371350
MIRT503239	hsa-miR-6858-3p	PAR-CLIP	20371350
MIRT503238	hsa-miR-4722-5p	PAR-CLIP	20371350
MIRT503237	hsa-miR-3194-5p	PAR-CLIP	20371350
MIRT503236	hsa-miR-505-5p	PAR-CLIP	20371350
MIRT503240	hsa-miR-6165	PAR-CLIP	23446348
MIRT503239	hsa-miR-6858-3p	PAR-CLIP	23446348
MIRT503238	hsa-miR-4722-5p	PAR-CLIP	23446348
MIRT503237	hsa-miR-3194-5p	PAR-CLIP	23446348
MIRT503236	hsa-miR-505-5p	PAR-CLIP	23446348
MIRT503240	hsa-miR-6165	PAR-CLIP	23446348
MIRT503239	hsa-miR-6858-3p	PAR-CLIP	23446348
MIRT503238	hsa-miR-4722-5p	PAR-CLIP	23446348
MIRT503237	hsa-miR-3194-5p	PAR-CLIP	23446348
MIRT503236	hsa-miR-505-5p	PAR-CLIP	23446348
MIRT835520	hsa-miR-1197	CLIP-seq
MIRT835521	hsa-miR-1207-5p	CLIP-seq
MIRT835522	hsa-miR-1909	CLIP-seq
MIRT835523	hsa-miR-198	CLIP-seq
MIRT835524	hsa-miR-2355-3p	CLIP-seq
MIRT835525	hsa-miR-3135b	CLIP-seq
MIRT835526	hsa-miR-3649	CLIP-seq
MIRT835527	hsa-miR-4253	CLIP-seq
MIRT835528	hsa-miR-4287	CLIP-seq
MIRT835529	hsa-miR-4292	CLIP-seq
MIRT835530	hsa-miR-4308	CLIP-seq
MIRT835531	hsa-miR-4436a	CLIP-seq
MIRT835532	hsa-miR-4469	CLIP-seq
MIRT835533	hsa-miR-4646-3p	CLIP-seq
MIRT835534	hsa-miR-4685-3p	CLIP-seq
MIRT835535	hsa-miR-4688	CLIP-seq
MIRT835536	hsa-miR-4763-3p	CLIP-seq
MIRT835537	hsa-miR-507	CLIP-seq
MIRT835538	hsa-miR-557	CLIP-seq
MIRT1947547	hsa-miR-3192	CLIP-seq
MIRT1947548	hsa-miR-3650	CLIP-seq
MIRT1947549	hsa-miR-3689a-3p	CLIP-seq
MIRT1947550	hsa-miR-3689c	CLIP-seq
MIRT1947551	hsa-miR-4455	CLIP-seq
MIRT1947552	hsa-miR-4488	CLIP-seq
MIRT1947553	hsa-miR-4492	CLIP-seq
MIRT1947554	hsa-miR-4498	CLIP-seq
MIRT1947555	hsa-miR-4505	CLIP-seq
MIRT1947556	hsa-miR-4697-5p	CLIP-seq
MIRT1947557	hsa-miR-4728-5p	CLIP-seq
MIRT1947558	hsa-miR-637	CLIP-seq
MIRT1947559	hsa-miR-762	CLIP-seq
MIRT2185519	hsa-miR-1228	CLIP-seq
MIRT2185520	hsa-miR-3153	CLIP-seq
MIRT835526	hsa-miR-3649	CLIP-seq
MIRT835528	hsa-miR-4287	CLIP-seq
MIRT835529	hsa-miR-4292	CLIP-seq
MIRT835530	hsa-miR-4308	CLIP-seq
MIRT835532	hsa-miR-4469	CLIP-seq
MIRT2185521	hsa-miR-4514	CLIP-seq
MIRT2185522	hsa-miR-4645-5p	CLIP-seq
MIRT2185523	hsa-miR-4646-5p	CLIP-seq
MIRT2185524	hsa-miR-4668-5p	CLIP-seq
MIRT2185525	hsa-miR-4673	CLIP-seq
MIRT835534	hsa-miR-4685-3p	CLIP-seq
MIRT2185526	hsa-miR-4691-3p	CLIP-seq
MIRT2185527	hsa-miR-4692	CLIP-seq
MIRT835522	hsa-miR-1909	CLIP-seq
MIRT835527	hsa-miR-4253	CLIP-seq
MIRT835535	hsa-miR-4688	CLIP-seq
MIRT835537	hsa-miR-507	CLIP-seq
MIRT835538	hsa-miR-557	CLIP-seq
MIRT2489727	hsa-miR-183	CLIP-seq
MIRT2489728	hsa-miR-3907	CLIP-seq
MIRT2489729	hsa-miR-578	CLIP-seq
MIRT835521	hsa-miR-1207-5p	CLIP-seq
MIRT2489727	hsa-miR-183	CLIP-seq
MIRT2489728	hsa-miR-3907	CLIP-seq
MIRT2676550	hsa-miR-4736	CLIP-seq
MIRT835536	hsa-miR-4763-3p	CLIP-seq
MIRT2489729	hsa-miR-578	CLIP-seq

Show/Hide all (1)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16189514, 25416956, 28881575, 32296183

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q96GX8

Protein name

Uncharacterized protein C16orf74

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15366	DUF4597	13 → 75	Domain of unknown function (DUF4597)	Family

Tissue specificity

TISSUE SPECIFICITY: [Isoform 1]: Not expressed in pancreatic duct cells (at protein level). Abundantly expressed in the pancreas and weakly expressed in the thyroid. {ECO:0000269|PubMed:28881575}.; TISSUE SPECIFICITY: [Isoform 2]: Not expressed in pancrea

Sequence

MGLKMSCLKGFQMCVSSSSSSHDEAPVLNDKHLDVPDIIITPPTPTGMMLPRDLGSTVWL
DETGSCPDDGEIDPEA

Sequence length

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (7)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	29371937, 31597713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	26818947		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	31597713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21203532, 29371937		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	31597713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	35234293	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	21203532	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

C16orf74 (chromosome 16 open reading frame 74)