LPO (lactoperoxidase)

Gene

• Entrez ID: 4025
• Gene name: Lactoperoxidase
• Gene symbol: LPO
• Synonyms (NCBI Gene): SPO
• Chromosome: 17
• Chromosome location: 17q22
• Summary: This gene encodes a member of the peroxidase family of proteins. The encoded preproprotein is proteolytically processed to generate the mature enzyme. Following its secretion from salivary, mammary, and other mucosal glands, this enzyme catalyzes the gene

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1116526	hsa-miR-3545-3p	CLIP-seq
MIRT1116527	hsa-miR-4475	CLIP-seq
MIRT1116528	hsa-miR-4521	CLIP-seq
MIRT1116529	hsa-miR-4704-3p	CLIP-seq
MIRT1116530	hsa-miR-616	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001580	Process	Detection of chemical stimulus involved in sensory perception of bitter taste	IDA	24248522
GO:0004601	Function	Peroxidase activity	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	24248522
GO:0005737	Component	Cytoplasm	IEA
GO:0006979	Process	Response to oxidative stress	IEA
GO:0006979	Process	Response to oxidative stress	NAS	8964511
GO:0016323	Component	Basolateral plasma membrane	IDA	19059195
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0018969	Process	Thiocyanate metabolic process	IEA
GO:0020037	Function	Heme binding	IEA
GO:0036393	Function	Thiocyanate peroxidase activity	IBA
GO:0036393	Function	Thiocyanate peroxidase activity	IDA	12626341
GO:0042742	Process	Defense response to bacterium	IBA
GO:0042742	Process	Defense response to bacterium	IDA	12626341
GO:0042744	Process	Hydrogen peroxide catabolic process	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0070062	Component	Extracellular exosome	HDA	19199708
GO:0098869	Process	Cellular oxidant detoxification	IEA
GO:0140825	Function	Lactoperoxidase activity	IEA

Other IDs

• MIM: 150205
• HGNC: 6678
• e!Ensembl: ENSG00000167419

Protein

• UniProt ID: P22079
• Protein name: Lactoperoxidase (LPO) (EC 1.11.1.7) (Salivary peroxidase) (SPO)
• Protein function: Heme-containing oxidoreductase which catalyzes the conversion of thiocyanate (SCN(-)) into antimicrobial agent hypothiocyanous acid (OSCN(-)) in the presence of hydrogen peroxide (H2O2) (By similarity). Also involved in the conversion of iodide
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03098	An_peroxidase	138 → 684	Animal haem peroxidase	Domain

• Tissue specificity: TISSUE SPECIFICITY: Mammary gland, milk and salivary gland. Found in bronchial submucosal glands. {ECO:0000269|PubMed:10715594, ECO:0000269|PubMed:12626341}.
• Sequence:

  MRVLLHLPALLASLILLQAAASTTRAQTTRTSAISDTVSQAKVQVNKAFLDSRTRLKTAM
  SSETPTSRQLSEYLKHAKGRTRTAIRNGQVWEESLKRLRQKASLTNVTDPSLDLTSLSLE
  VGCGAPAPVVRCDPCSPYRTITGDCNNRRKPALGAANRALARWLPAEYEDGLSLPFGWTP
  GKTRNGFPLPLAREVSNKIVGYLNEEGVLDQNRSLLFMQWGQIVDHDLDFAPDTELGSSE
  YSKAQCDEYCIQGDNCFPIMFPPNDPKAGTQGKCMPFFRAGFVCPTPPYKSLAREQINAL
  TSFLDASFVYSSEPSLASRLRNLSSPLGLMAVNQEVSDHGLPYLPYDSKKPSPCEFINTT
  ARVPCFLAGDSRASEHILLATSHTLFLREHNRLARELKRLNPQWDGEKLYQEARKILGAF
  VQIITFRDYLPILLGDHMQKWIPPYQGYSESVDPRISNVFTFAFRFGHLEVPSSMFRLDE
  NYQPWGPEPELPLHTLFFNTWRMVKDGGIDPLVRGLLAKKSKLMKQNKMMTGELRNKLFQ
  PTHRIHGFDLAAINTQRCRDHGQPGYNSWRAFCDLSQPQTLEELNTVLKSKMLAKKLLGL
  YGTPDNIDIWIGAIAEPLVERGRVGPLLACLLGKQFQQIRDGDRFWWENPGVFTNEQKDS
  LQKMSFSRLVCDNTRITKVPRDPFWANSYPYDFVDCSAIDKLDLSPWASVKN

• Sequence length: 712

Pathways

KEGG:

Salivary secretion
Chemical carcinogenesis - reactive oxygen species

Reactome:

Events associated with phagocytolytic activity of PMN cells

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE, FAMILIAL, 1	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
BARDET-BIEDL SYNDROME 13	Bardet-Biedl Syndrome	CLINVAR_DG	16415886, 17397051		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	19794300, 28536577, 29061807, 29061827, 31597313		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	GWASCAT_DG	26634245		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	17204267, 31740228		★☆☆☆☆ Found in Text Mining only
Dental Caries	Dental caries	Pubtator	21940522, 39543892	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic angiopathies	Pubtator	39519313	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic Nephropathy	BEFREE	30393023		★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry eye syndrome	Pubtator	29234088	Associate	★☆☆☆☆ Found in Text Mining only
Familial aplasia of the vermis	Cerebellar vermis agenesis	CLINVAR_DG	17397051, 26092869		★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingivitis	BEFREE	31292969		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	10994878	Associate	★☆☆☆☆ Found in Text Mining only
JOUBERT SYNDROME 28	Joubert Syndrome	CLINVAR_DG	16415886, 17397051		★☆☆☆☆ Found in Text Mining only
Kidney Calculi	Kidney stone	BEFREE	28808392		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19794300, 28536577, 29061807, 29061827, 31597313		★☆☆☆☆ Found in Text Mining only
Meckel syndrome type 1	Meckel Syndrome	CLINVAR_DG	16415886, 17397051		★☆☆☆☆ Found in Text Mining only
Meckel-Gruber syndrome	Meckel-Gruber Syndrome	CLINVAR_DG	17397051		★☆☆☆☆ Found in Text Mining only
Meibomian gland dysfunction	Meibomian Gland Dysfunction	BEFREE	29234088		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	91379	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	37299978	Associate	★☆☆☆☆ Found in Text Mining only
MUTYH-Associate Polyposis	Polyposis	BEFREE	31195975		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	LHGDN	15384204		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	28555944		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	27814717	Associate	★☆☆☆☆ Found in Text Mining only
Urolithiasis	Urolithiasis	BEFREE	28808392		★☆☆☆☆ Found in Text Mining only