LPL (lipoprotein lipase)

Gene

• Entrez ID: 4023
• Gene name: Lipoprotein lipase
• Gene symbol: LPL
• Synonyms (NCBI Gene): HDLCQ11, LIPD
• Chromosome: 8
• Chromosome location: 8p21.3
• Summary: LPL encodes lipoprotein lipase, which is expressed in heart, muscle, and adipose tissue. LPL functions as a homodimer, and has the dual functions of triglyceride hydrolase and ligand/bridging factor for receptor-mediated lipoprotein uptake. Severe mutatio

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs268	A>G	Pathogenic, uncertain-significance, risk-factor	Missense variant, coding sequence variant
rs1801177	G>A,C	Other, benign-likely-benign, likely-benign, risk-factor	Missense variant, coding sequence variant
rs11542065	C>G,T	Conflicting-interpretations-of-pathogenicity	Synonymous variant, coding sequence variant, missense variant
rs118204056	G>A	Pathogenic	Missense variant, coding sequence variant
rs118204057	G>A,C	Pathogenic	Missense variant, coding sequence variant
rs118204058	C>G,T	Pathogenic	Missense variant, stop gained, coding sequence variant
rs118204059	T>A	Pathogenic	Missense variant, coding sequence variant
rs118204060	C>T	Pathogenic	Missense variant, coding sequence variant
rs118204061	T>C	Pathogenic	Missense variant, coding sequence variant
rs118204062	G>A	Pathogenic	Missense variant, coding sequence variant
rs118204063	G>A	Pathogenic	Missense variant, coding sequence variant
rs118204064	A>G	Pathogenic	Missense variant, coding sequence variant
rs118204065	T>A	Pathogenic	Stop gained, coding sequence variant
rs118204066	G>A	Pathogenic	Stop gained, coding sequence variant
rs118204067	C>G	Pathogenic	Missense variant, coding sequence variant
rs118204068	G>A	Pathogenic	Missense variant, coding sequence variant
rs118204069	T>C	Pathogenic	Missense variant, coding sequence variant
rs118204070	G>A	Pathogenic	Stop gained, coding sequence variant
rs118204071	G>A	Pathogenic	Missense variant, coding sequence variant
rs118204072	C>G,T	Pathogenic	Missense variant, coding sequence variant
rs118204073	A>C	Pathogenic	Missense variant, coding sequence variant
rs118204074	C>A,T	Pathogenic	Synonymous variant, stop gained, coding sequence variant
rs118204075	G>A	Pathogenic	Missense variant, coding sequence variant
rs118204076	C>G,T	Pathogenic	Synonymous variant, missense variant, coding sequence variant
rs118204077	C>T	Pathogenic	Missense variant, coding sequence variant
rs118204078	C>G	Pathogenic	Missense variant, coding sequence variant
rs118204079	G>A	Pathogenic	Missense variant, coding sequence variant
rs118204080	T>C	Pathogenic	Missense variant, coding sequence variant
rs118204081	C>A	Pathogenic	Stop gained, coding sequence variant
rs118204082	C>G,T	Likely-benign, pathogenic	Synonymous variant, missense variant, coding sequence variant
rs372668179	G>A,T	Pathogenic	Missense variant, coding sequence variant
rs766134215	G>C,T	Pathogenic	Splice donor variant
rs886037774	T>C	Likely-pathogenic	Coding sequence variant, missense variant
rs886037775	A>T	Likely-pathogenic	Coding sequence variant, missense variant
rs1064797075	T>C	Likely-pathogenic	Missense variant, coding sequence variant
rs1297688787	C>T	Pathogenic	Coding sequence variant, stop gained
rs1554517725	G>A	Likely-pathogenic	Coding sequence variant, missense variant
rs1563569634	G>A	Pathogenic	Splice donor variant
rs1563572716	G>A	Pathogenic	Splice acceptor variant
rs1563575252	G>-	Pathogenic	Coding sequence variant, frameshift variant
rs1590134297	G>A	Pathogenic	Stop gained, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT001542	hsa-miR-155-5p	pSILAC	18668040
MIRT005491	hsa-miR-138-5p	qRT-PCR	20486779
MIRT005584	hsa-miR-29a-3p	ELISA, Luciferase reporter assay, qRT-PCR, Western blot	21276447
MIRT019335	hsa-miR-148b-3p	Microarray	17612493
MIRT001542	hsa-miR-155-5p	Proteomics;Other	18668040
MIRT032343	hsa-let-7b-5p	Proteomics	18668040
MIRT616693	hsa-miR-3130-3p	HITS-CLIP	23824327
MIRT616692	hsa-miR-4793-3p	HITS-CLIP	23824327
MIRT616691	hsa-miR-767-5p	HITS-CLIP	23824327
MIRT616690	hsa-miR-544a	HITS-CLIP	23824327
MIRT616689	hsa-miR-6738-3p	HITS-CLIP	23824327
MIRT616693	hsa-miR-3130-3p	HITS-CLIP	23824327
MIRT616692	hsa-miR-4793-3p	HITS-CLIP	23824327
MIRT616691	hsa-miR-767-5p	HITS-CLIP	23824327
MIRT616690	hsa-miR-544a	HITS-CLIP	23824327
MIRT616689	hsa-miR-6738-3p	HITS-CLIP	23824327
MIRT616693	hsa-miR-3130-3p	HITS-CLIP	23824327
MIRT616692	hsa-miR-4793-3p	HITS-CLIP	23824327
MIRT616691	hsa-miR-767-5p	HITS-CLIP	23824327
MIRT616690	hsa-miR-544a	HITS-CLIP	23824327
MIRT616689	hsa-miR-6738-3p	HITS-CLIP	23824327
MIRT616693	hsa-miR-3130-3p	HITS-CLIP	23824327
MIRT616692	hsa-miR-4793-3p	HITS-CLIP	23824327
MIRT616691	hsa-miR-767-5p	HITS-CLIP	23824327
MIRT616690	hsa-miR-544a	HITS-CLIP	23824327
MIRT616689	hsa-miR-6738-3p	HITS-CLIP	23824327
MIRT005491	hsa-miR-138-5p	Next Generation Sequencing (NGS), qRT-PCR	27762728
MIRT005491	hsa-miR-138-5p	Next Generation Sequencing (NGS), qRT-PCR	27762728
MIRT005491	hsa-miR-138-5p	Luciferase reporter assay, Western blotting, qRT-PCR	31769250
MIRT616693	hsa-miR-3130-3p	HITS-CLIP	23824327
MIRT616692	hsa-miR-4793-3p	HITS-CLIP	23824327
MIRT616691	hsa-miR-767-5p	HITS-CLIP	23824327
MIRT616690	hsa-miR-544a	HITS-CLIP	23824327
MIRT616689	hsa-miR-6738-3p	HITS-CLIP	23824327
MIRT616693	hsa-miR-3130-3p	HITS-CLIP	23824327
MIRT616692	hsa-miR-4793-3p	HITS-CLIP	23824327
MIRT616691	hsa-miR-767-5p	HITS-CLIP	23824327
MIRT616690	hsa-miR-544a	HITS-CLIP	23824327
MIRT616689	hsa-miR-6738-3p	HITS-CLIP	23824327
MIRT616693	hsa-miR-3130-3p	HITS-CLIP	23824327
MIRT616692	hsa-miR-4793-3p	HITS-CLIP	23824327
MIRT616691	hsa-miR-767-5p	HITS-CLIP	23824327
MIRT616690	hsa-miR-544a	HITS-CLIP	23824327
MIRT616689	hsa-miR-6738-3p	HITS-CLIP	23824327
MIRT616693	hsa-miR-3130-3p	HITS-CLIP	23824327
MIRT616692	hsa-miR-4793-3p	HITS-CLIP	23824327
MIRT616691	hsa-miR-767-5p	HITS-CLIP	23824327
MIRT616690	hsa-miR-544a	HITS-CLIP	23824327
MIRT616689	hsa-miR-6738-3p	HITS-CLIP	23824327
MIRT755670	hsa-miR-27a-3p	Luciferase reporter assay, Western blotting, qRT-PCR	34831427
MIRT1116487	hsa-miR-1279	CLIP-seq
MIRT1116488	hsa-miR-1298	CLIP-seq
MIRT1116489	hsa-miR-155	CLIP-seq
MIRT1116490	hsa-miR-1912	CLIP-seq
MIRT1116491	hsa-miR-204	CLIP-seq
MIRT1116492	hsa-miR-211	CLIP-seq
MIRT1116493	hsa-miR-23a	CLIP-seq
MIRT1116494	hsa-miR-23b	CLIP-seq
MIRT1116495	hsa-miR-23c	CLIP-seq
MIRT1116496	hsa-miR-27a	CLIP-seq
MIRT1116497	hsa-miR-27b	CLIP-seq
MIRT1116498	hsa-miR-3130-5p	CLIP-seq
MIRT1116499	hsa-miR-3620	CLIP-seq
MIRT1116500	hsa-miR-3664-5p	CLIP-seq
MIRT1116501	hsa-miR-3682-5p	CLIP-seq
MIRT1116502	hsa-miR-371-5p	CLIP-seq
MIRT1116503	hsa-miR-3913-3p	CLIP-seq
MIRT1116504	hsa-miR-3919	CLIP-seq
MIRT1116505	hsa-miR-3925-5p	CLIP-seq
MIRT1116506	hsa-miR-412	CLIP-seq
MIRT1116507	hsa-miR-4292	CLIP-seq
MIRT1116508	hsa-miR-4436b-5p	CLIP-seq
MIRT1116509	hsa-miR-4446-5p	CLIP-seq
MIRT1116510	hsa-miR-4482	CLIP-seq
MIRT1116511	hsa-miR-452	CLIP-seq
MIRT1116512	hsa-miR-4676-3p	CLIP-seq
MIRT1116513	hsa-miR-4691-5p	CLIP-seq
MIRT1116514	hsa-miR-4714-5p	CLIP-seq
MIRT1116515	hsa-miR-4717-3p	CLIP-seq
MIRT1116516	hsa-miR-4755-5p	CLIP-seq
MIRT1116517	hsa-miR-4795-3p	CLIP-seq
MIRT1116518	hsa-miR-489	CLIP-seq
MIRT1116519	hsa-miR-501-3p	CLIP-seq
MIRT1116520	hsa-miR-502-3p	CLIP-seq
MIRT1116521	hsa-miR-513a-5p	CLIP-seq
MIRT1116522	hsa-miR-514	CLIP-seq
MIRT1116523	hsa-miR-514b-3p	CLIP-seq
MIRT1116524	hsa-miR-569	CLIP-seq
MIRT1116525	hsa-miR-623	CLIP-seq
MIRT1116496	hsa-miR-27a	CLIP-seq
MIRT1116497	hsa-miR-27b	CLIP-seq
MIRT2032885	hsa-miR-873	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
NFKB1	Activation	20200316
PPARA	Activation	10634806
PPARD	Activation	10634806
RELA	Activation	20200316
SP1	Unknown	18793716;9788252
SP3	Activation	9788252
SP3	Unknown	18793716

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001523	Process	Retinoid metabolic process	IEA
GO:0004465	Function	Lipoprotein lipase activity	IBA
GO:0004465	Function	Lipoprotein lipase activity	IDA	2110364, 2340307, 3973011, 11342582, 27578112, 30559189
GO:0004465	Function	Lipoprotein lipase activity	IEA
GO:0004465	Function	Lipoprotein lipase activity	IMP	25149060
GO:0004465	Function	Lipoprotein lipase activity	ISS	10727238
GO:0004620	Function	Phospholipase activity	ISS	10727238
GO:0004806	Function	Triacylglycerol lipase activity	IDA	182536, 7592706, 12032167, 12573449
GO:0004806	Function	Triacylglycerol lipase activity	IEA
GO:0004806	Function	Triacylglycerol lipase activity	ISS	10727238
GO:0005102	Function	Signaling receptor binding	IPI	10085125
GO:0005509	Function	Calcium ion binding	IDA	16179346, 30559189
GO:0005515	Function	Protein binding	IPI	7417307, 19542565, 20124439, 21385844, 30559189, 32814053
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	2340307, 11342582, 12573449, 27578112, 30559189
GO:0005615	Component	Extracellular space	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	IDA	11342582, 27578112
GO:0006633	Process	Fatty acid biosynthetic process	IBA
GO:0006633	Process	Fatty acid biosynthetic process	IC	3973011
GO:0006633	Process	Fatty acid biosynthetic process	IDA	182536
GO:0006633	Process	Fatty acid biosynthetic process	ISS
GO:0006641	Process	Triglyceride metabolic process	IEA
GO:0006641	Process	Triglyceride metabolic process	IMP	12573449
GO:0006641	Process	Triglyceride metabolic process	ISS	10727238
GO:0006644	Process	Phospholipid metabolic process	ISS	10727238
GO:0008201	Function	Heparin binding	IDA	2110364, 11342582, 12573449
GO:0008201	Function	Heparin binding	IEA
GO:0008201	Function	Heparin binding	TAS	1969408
GO:0008970	Function	Phospholipase A1 activity	IBA
GO:0008970	Function	Phospholipase A1 activity	IDA	7592706, 12032167
GO:0008970	Function	Phospholipase A1 activity	IEA
GO:0009617	Process	Response to bacterium	IEA
GO:0009749	Process	Response to glucose	ISS
GO:0009986	Component	Cell surface	IEA
GO:0010744	Process	Positive regulation of macrophage derived foam cell differentiation	IEA
GO:0010744	Process	Positive regulation of macrophage derived foam cell differentiation	IMP	12573449
GO:0010884	Process	Positive regulation of lipid storage	TAS	24608080
GO:0010886	Process	Positive regulation of cholesterol storage	IMP	12573449
GO:0016020	Component	Membrane	IEA
GO:0016042	Process	Lipid catabolic process	IEA
GO:0016298	Function	Lipase activity	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0019433	Process	Triglyceride catabolic process	IBA
GO:0019433	Process	Triglyceride catabolic process	IDA	182536, 2110364, 2340307, 3973011, 11342582, 27578112, 30559189
GO:0019433	Process	Triglyceride catabolic process	IEA
GO:0019433	Process	Triglyceride catabolic process	ISS
GO:0031670	Process	Cellular response to nutrient	IEA
GO:0031670	Process	Cellular response to nutrient	ISS
GO:0032722	Process	Positive regulation of chemokine production	IMP	25149060
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IEA
GO:0032731	Process	Positive regulation of interleukin-1 beta production	ISS
GO:0032755	Process	Positive regulation of interleukin-6 production	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	ISS
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IEA
GO:0032760	Process	Positive regulation of tumor necrosis factor production	ISS
GO:0034185	Function	Apolipoprotein binding	IBA
GO:0034185	Function	Apolipoprotein binding	IPI	15178420
GO:0034361	Component	Very-low-density lipoprotein particle	IEA
GO:0034371	Process	Chylomicron remodeling	IC	3973011
GO:0034371	Process	Chylomicron remodeling	IMP	11342582
GO:0034372	Process	Very-low-density lipoprotein particle remodeling	IBA
GO:0034372	Process	Very-low-density lipoprotein particle remodeling	IDA	3973011
GO:0034372	Process	Very-low-density lipoprotein particle remodeling	IMP	12573449
GO:0034372	Process	Very-low-density lipoprotein particle remodeling	ISS
GO:0034375	Process	High-density lipoprotein particle remodeling	IBA
GO:0034447	Process	Very-low-density lipoprotein particle clearance	IEA
GO:0034447	Process	Very-low-density lipoprotein particle clearance	ISS	15178420
GO:0042627	Component	Chylomicron	IEA
GO:0042632	Process	Cholesterol homeostasis	IBA
GO:0042632	Process	Cholesterol homeostasis	IMP	25149060
GO:0042803	Function	Protein homodimerization activity	IDA	16179346
GO:0043395	Function	Heparan sulfate proteoglycan binding	IMP	11342582
GO:0043495	Function	Protein-membrane adaptor activity	TAS	24608080
GO:0045600	Process	Positive regulation of fat cell differentiation	IMP	29794473, 31769250
GO:0046872	Function	Metal ion binding	IEA
GO:0050729	Process	Positive regulation of inflammatory response	IEA
GO:0050729	Process	Positive regulation of inflammatory response	IMP	25149060
GO:0050729	Process	Positive regulation of inflammatory response	ISS
GO:0052689	Function	Carboxylic ester hydrolase activity	IEA
GO:0055096	Process	Low-density lipoprotein particle mediated signaling	IMP	25149060
GO:0070328	Process	Triglyceride homeostasis	IGI	17018885
GO:0070328	Process	Triglyceride homeostasis	NAS	30559189
GO:0071398	Process	Cellular response to fatty acid	IEA
GO:0071398	Process	Cellular response to fatty acid	ISS
GO:0071813	Function	Lipoprotein particle binding	IDA	11342582
GO:1902494	Component	Catalytic complex	IPI	30559189
GO:1904179	Process	Positive regulation of adipose tissue development	IMP	31769250
GO:2000343	Process	Positive regulation of chemokine (C-X-C motif) ligand 2 production	IEA
GO:2000343	Process	Positive regulation of chemokine (C-X-C motif) ligand 2 production	ISS

Other IDs

• MIM: 609708
• HGNC: 6677
• e!Ensembl: ENSG00000175445

Protein

• UniProt ID: P06858
• Protein name: Lipoprotein lipase (LPL) (EC 3.1.1.34) (Phospholipase A1) (EC 3.1.1.32)
• Protein function: Key enzyme in triglyceride metabolism. Catalyzes the hydrolysis of triglycerides from circulating chylomicrons and very low density lipoproteins (VLDL), and thereby plays an important role in lipid clearance from the blood stream, lipid utilizat
• PDB: 6E7K, 6OAU, 6OAZ, 6OB0, 6WN4
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00151	Lipase	17 → 338	Lipase	Domain
  PF01477	PLAT	343 → 463	PLAT/LH2 domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Detected in blood plasma (PubMed:11893776, PubMed:12641539, PubMed:2340307). Detected in milk (at protein level) (PubMed:2340307). {ECO:0000269|PubMed:11893776, ECO:0000269|PubMed:12641539, ECO:0000269|PubMed:2340307}.
• Sequence:

  MESKALLVLTLAVWLQSLTASRGGVAAADQRRDFIDIESKFALRTPEDTAEDTCHLIPGV
  AESVATCHFNHSSKTFMVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLSRAQEH
  YPVSAGYTKLVGQDVARFINWMEEEFNYPLDNVHLLGYSLGAHAAGIAGSLTNKKVNRIT
  GLDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGGTFQ
  PGCNIGEAIRVIAERGLGDVDQLVKCSHERSIHLFIDSLLNEENPSKAYRCSSKEAFEKG
  LCLSCRKNRCNNLGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFSGTESETHTNQ
  AFEISLYGTVAESENIPFTLPEVSTNKTYSFLIYTEVDIGELLMLKLKWKSDSYFSWSDW
  WSSPGFAIQKIRVKAGETQKKVIFCSREKVSHLQKGKAPAVFVKCHDKSLNKKSG

• Sequence length: 475

Pathways

KEGG:

Glycerolipid metabolism
PPAR signaling pathway
Cholesterol metabolism
Alzheimer disease

Reactome:

Transcriptional regulation of white adipocyte differentiation
Assembly of active LPL and LIPC lipase complexes
Chylomicron remodeling
Retinoid metabolism and transport

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Cardiovascular phenotype	Pathogenic; Likely pathogenic	rs761886494, rs145657341, rs373088068, rs762007406, rs768128481, rs2128839625, rs372668179, rs1416098529, rs2128839190, rs118204057, rs118204060, rs118204062, rs1563569634, rs118204065, rs118204068, rs118204070, rs118204077, rs767366957, rs2540092267, rs2540111594, rs2540107190, rs751554200, rs371282890, rs35414700, rs767260655	RCV002420853 RCV002440807 RCV005660151 RCV003299025 RCV002352679 RCV005370042 RCV005654901 RCV002343994 RCV002352653 RCV002362549 RCV002362550 RCV002415385 RCV002426478 RCV002453245 RCV002426479 RCV005589768 RCV002415386 RCV002352961 RCV002359886 RCV002385709 RCV004278842 RCV004369267 RCV004031932 RCV004031763 RCV002322168	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Hyperlipidemia, familial combined, LPL related	Likely pathogenic; Pathogenic	rs781614031, rs145657341, rs762007406, rs2128838185, rs2128839227, rs118204057, rs118204060, rs118204062, rs1563569634, rs118204066, rs118204068, rs118204069, rs118204070, rs118204071, rs118204077, rs118204080, rs587777909, rs766134215, rs2128838188, rs2128838564, rs767366957, rs780013139, rs2540103296, rs2540109673, rs2540107050, rs1064797075, rs371282890, rs1409123950	RCV002246352 RCV002501917 RCV002246536 RCV002490029 RCV005042469 RCV000763181 RCV001253353 RCV001248901 RCV001537867 RCV002504736 RCV002476909 RCV001197456 RCV001813730 RCV002247233 RCV005049311 RCV005041965 RCV002249096 RCV002250095 RCV002250097 RCV002250099 RCV004690276 RCV002466920 RCV003991301 RCV003992029 RCV005040701 RCV000487457 RCV002505628 RCV001537868	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Hyperlipoproteinemia, type I	Likely pathogenic; Pathogenic	rs2069982771, rs781614031, rs761886494, rs145657341, rs775728208, rs2128838194, rs762007406, rs2128838185, rs2128839190, rs2128839227, rs118204056, rs118204057, rs118204058, rs118204059, rs1563572716, rs118204060, rs118204067, rs118204062, rs118204074, rs118204063, rs118204064, rs1563569634, rs118204065, rs118204066, rs1563575252, rs118204068, rs118204069, rs118204070, rs766134215, rs118204071, rs118204072, rs118204073, rs118204075, rs118204076, rs118204077, rs118204078, rs118204079, rs118204080, rs118204081, rs118204082, rs2128839600, rs767366957, rs773407951, rs886037774, rs2540107223, rs2540107190, rs2540107342, rs571478179, rs2069961546, rs2540107050, rs1554517725, rs371282890, rs35414700, rs767260655, rs2070032216, rs1409123950, rs1563575291	RCV001332300 RCV001732177 RCV001831346 RCV001827495 RCV001580615 RCV001619762 RCV001823501 RCV002490029 RCV003994365 RCV005042469 RCV000001583 RCV000001586 RCV000001588 RCV000001589 RCV000001590 RCV000001591 RCV000001592 RCV000001594 RCV000001595 RCV000001596 RCV000001597 RCV000001599 RCV000001600 RCV000001601 RCV000001602 RCV000001604 RCV000001605 RCV000001606 RCV000001607 RCV000001608 RCV000001609 RCV000001610 RCV000001611 RCV000001612 RCV000001613 RCV000001616 RCV000001618 RCV000001619 RCV000001621 RCV000001623 RCV003988878 RCV002260532 RCV003314049 RCV000258506 RCV003127194 RCV003127227 RCV005616618 RCV003333683 RCV005931448 RCV004546805 RCV004587947 RCV000625872 RCV002505628 RCV001809969 RCV001250243 RCV001250245 RCV001257912 RCV001526865	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Lipase deficiency, combined	Likely pathogenic; Pathogenic	rs2069982771	RCV003987837	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
LIPOPROTEIN LIPASE (OLBIA)	Pathogenic	rs118204081	RCV000001622	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
LPL-related disorder	Likely pathogenic; Pathogenic	rs145657341, rs118204057, rs118204060, rs118204077	RCV003405720 RCV003415622 RCV003964785 RCV003894783	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMERS DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANOREXIA NERVOSA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AORTIC STENOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AORTIC VALVE CALCIFICATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, BASAL CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHIES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY, FAMILIAL IDIOPATHIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CELIAC DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONNECTIVE TISSUE NEOPLASM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ATHEROSCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Benign; Likely benign; other	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dilated cardiomyopathy 1A	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSLIPIDEMIAS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dystrophin deficiency	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL HYPERLIPIDEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL LIPOPROTEIN LIPASE DEFICIENCY	—	GWAS catalog, GenCC, Orphanet GWAS catalog, GenCC, Orphanet GWAS catalog, GenCC, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS C	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
High density lipoprotein cholesterol level quantitative trait locus 11	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERCHOLESTEROLEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERCHOLESTEROLEMIA, FAMILIAL	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERLIPIDEMIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERLIPIDEMIA, FAMILIAL COMBINED	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERLIPIDEMIA, FAMILIAL COMBINED, 3	—	HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperlipidemia, familial combined, susceptibility to	Uncertain significance; Conflicting classifications of pathogenicity; Benign; Likely benign; other	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERLIPIDEMIAS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERLIPOPROTEINEMIA TYPE I	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERLIPOPROTEINEMIA TYPE II	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERLIPOPROTEINEMIAS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertriglyceridemia	Conflicting classifications of pathogenicity	ClinVar CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
INTERMEDIATE CORONARY SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NECROSIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATITIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL ARTERIAL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY CARDIOMYOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VASCULAR DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acne	Acne	BEFREE	28025036		★☆☆☆☆ Found in Text Mining only
Acne Vulgaris	Acne	BEFREE	28025036		★☆☆☆☆ Found in Text Mining only
Acromegaly	Acromegaly	Pubtator	26087292	Associate	★☆☆☆☆ Found in Text Mining only
Acromegaly	Acromegaly	BEFREE	7593431		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	29650292		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	24646025, 29921298, 30318066, 30318473, 30420299		★☆☆☆☆ Found in Text Mining only
Acute recurrent pancreatitis	Pancreatitis	BEFREE	16552344, 28548960, 29921298		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	17347923		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	9770500		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	17347923		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	20385819, 21906714, 22618592, 24223199, 24498989, 24608419, 26503844, 30399423		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	19639021, 33213512	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	11018310, 15331147, 27897113		★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	CTD_human_DG	12376462		★☆☆☆☆ Found in Text Mining only
Apolipoprotein C-II Deficiency (disorder)	Apolipoprotein C2 deficiency	BEFREE	12120223, 17542893		★☆☆☆☆ Found in Text Mining only
Apolipoprotein C-II Deficiency (disorder)	Apolipoprotein C2 deficiency	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	10484615, 10871197, 10946021, 11477088, 11701470, 11730817, 11921083, 12032161, 12401876, 12483461, 12641539, 12690214, 1466662, 15122303, 15545743, 15639492, 1569193, 15928243, 16174715, 16357806, 16635607, 16755277, 17032721, 17087965, 17662793, 17761930, 17854791, 22772754, 25463094, 27039080, 27257686, 27678191, 28205069, 28444107, 28814963, 28855441, 29153744, 29175215, 29307667, 29419410, 29425239, 29453968, 29493553, 30232292, 30439364, 30471854, 31169351, 31518965, 7647785, 7834891, 8026810, 8044414, 8129039, 8576640, 8692976, 8843465, 8882874, 9193431, 9264476, 9430364		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	28774272	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	10191298, 11796707, 11861663, 15545743, 1569193, 15961789, 15994321, 17093291, 17662793, 19368142, 23991054, 28444107, 30333156, 8129039, 8408628, 8576640, 8778602	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	10484615, 10871197, 10946021, 11477088, 11701470, 11730817, 11914743, 11921083, 12032161, 12401876, 12483461, 12641539, 12690214, 1466662, 15122303, 15545743, 15639492, 1569193, 15928243, 16174715, 16357806, 16635607, 16755277, 17032721, 17087965, 17662793, 17761930, 17854791, 22772754, 25463094, 27039080, 27257686, 27678191, 28205069, 28444107, 28814963, 28855441, 29153744, 29175215, 29307667, 29419410, 29453968, 29493553, 30232292, 30439364, 30471854, 31169351, 31518965, 7647785, 7669092, 7834891, 8026810, 8044414, 8129039, 8576640, 8692976, 8843465, 8882874, 9193431, 9264476, 9430364		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	12483461, 12690214, 15928243, 16755277		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	38127052	Inhibit	★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	37628702	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	10576767, 28916403		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	11511560	Associate	★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	15858619, 16617321, 17158192, 18079738		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	12708905	Associate	★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	15386377, 24568597		★☆☆☆☆ Found in Text Mining only
Brain Infarction	Brain Infarction	BEFREE	11680797		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	17428620, 31806729		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	34404457, 39379897	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	11796839, 7698754		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	CTD_human_DG	12376462		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31740790	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	17620184		★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	22782350, 37856813	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	CTD_human_DG	12376462		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	CTD_human_DG	10533957		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies	Cardiomyopathy	BEFREE	12569168, 12594240, 14634011, 18515784		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies, Primary	Cardiomyopathy	CTD_human_DG	10533957		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	31024045	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	14634011, 17139480		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	10406818, 10554701, 10559015, 10636447, 11073182, 11441189, 12652096, 12691171, 14686956, 16106048, 16141008, 16253639, 17484619, 17803213, 19052449, 20429872, 21146168, 24990426, 25255477, 26853140, 27097985, 27771332, 30648986, 30694319, 8096867, 9498535		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular disease	Pubtator	16106048, 16141008, 24990426, 36690263, 40179477, 8096867	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular Diseases	CTD_human_DG	16544732		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carotid Stenosis	Carotid artery stenosis	BEFREE	16430904, 9352244		★☆☆☆☆ Found in Text Mining only
Castleman Disease	Castleman disease	Pubtator	34686774	Associate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	CTD_human_DG	30097691		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Infarction	Cerebral Infarction	BEFREE	11441189, 11921083, 18590804, 26853140		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	16519597, 27415775	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	LHGDN	17029199, 18590804		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	10723106, 11921083, 12636935, 21816453, 22541364, 22810051, 24990426, 28687421, 30140409		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	10821816, 11127970, 11680797, 12636935, 15896905, 22541364, 26853140		★☆☆☆☆ Found in Text Mining only
Cholesteryl Ester Transfer Protein Deficiency	Hyperalphalipoproteinemia	BEFREE	12889988		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	29913451, 30550765		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	15802535, 15858619, 16434371, 16617321, 17158192, 18079738, 18337555, 18616755, 18784741, 19340428, 19698929, 19709746, 21508119, 23160450, 23478142, 23614796, 25811490, 27504855, 27757836, 29206143, 29453968, 29465264, 29953583, 30182737		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	LHGDN	16840197, 17487735		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	17072956	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	CTD_human_DG	15059925		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	8291601	Associate	★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	17319789, 18616755, 27757836		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	29419410		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	10091829, 10191298, 10407505, 10450862, 10704617, 10974229, 11140837, 11171287, 11246452, 11427211, 11441189, 11680797, 11683775, 11730816, 12048130, 12133533, 12408999, 12535736, 12641539, 12708905, 12747600, 12865761, 12919138, 14580165, 1466662, 15115692, 15270617, 15292370, 15657615, 16002740, 16168296, 17291198, 17473385, 17721767, 18068174, 18242618, 19185650, 19368142, 20430250, 21127884, 22729917, 22837712, 23377670, 23902956, 26188224, 26934567, 28267856, 28275220, 29174344, 29425239, 29899519, 30694319, 31599081, 7834891, 8279486, 8641022, 8835323, 8873668, 8907213, 9017514, 9550358, 9627528, 9708657, 9719626		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	BEFREE	10091829, 10191298, 10407505, 10450862, 10484057, 10554701, 10974229, 11171287, 11427211, 11441189, 11680797, 11683775, 11730816, 11872694, 12048130, 12133533, 12408999, 12535736, 12641539, 12708905, 12747600, 12865761, 12919138, 12964943, 15115692, 15253101, 15270617, 15292370, 15657615, 16002740, 16168296, 16769999, 16822320, 16965549, 17291198, 17473385, 17533471, 17721767, 17848837, 18068174, 18242618, 18922999, 19185650, 19368142, 20430250, 21127884, 22729917, 22837712, 23377670, 23902956, 26188224, 26934567, 27986550, 28143480, 28267856, 28275220, 28705542, 29083408, 29174344, 29412239, 29425239, 29459423, 30326043, 30651409, 30694319, 30902787, 30958112, 31227920, 31599081, 8279486, 8641022, 8767463, 8835323, 8907213, 9017514, 9193431, 9489234, 9550358, 9627528, 9708657, 9719626		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	10091829, 10191298, 11316129, 12708905, 12964943, 15253101, 15270617, 1569193, 19368142, 20150529, 21889313, 22837712, 26934567, 28167353, 28267856, 29083408, 34385509, 34672391, 35278410, 36814994, 9017514, 9508003, 9799092	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	LHGDN	12747600, 12865761, 15657615, 17342071, 17473385		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	GWASDB_DG	23202125, 24262325		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	GWASCAT_DG	29212778		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Disease	Coronary artery disease	Pubtator	10946018, 11230170, 11714860, 15189363, 15292370, 16168296, 16822320, 17533471, 19185650, 19639021, 20650961, 21347282, 21804106, 22042884, 26188224, 26934567, 29412239, 30326043, 30694319, 33351885, 35456470, 39868518, 8169525, 8576640	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	10091829, 10191298, 10450862, 10554701, 10729390, 10974229, 11171287, 11427211, 11441189, 11680797, 11683775, 11730816, 12048130, 12133533, 12408999, 12535736, 12542551, 12641539, 12708905, 12747600, 12865761, 12919138, 14686956, 15115692, 15270617, 15292370, 15657615, 16002740, 16168296, 16419488, 16741292, 16822320, 17130180, 17291198, 17473385, 17533471, 17562973, 17721767, 18068174, 18242618, 18922999, 19185650, 19191728, 19368142, 20430250, 21127884, 21804106, 21960661, 22042884, 22729917, 22837712, 23377670, 23902956, 26188224, 26934567, 28267856, 28275220, 29174344, 29412239, 29425239, 29800275, 30326043, 30694319, 31599081, 7669092, 8279486, 8576640, 8641022, 8835323, 8907213, 9017514, 9550358, 9627528, 9708657, 9719626		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Coronary heart disease	Coronary Heart Disease	LHGDN	12408999		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Coronary heart disease	Coronary Heart Disease	GWASDB_DG	21347282		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Coronary heart disease	Coronary Heart Disease	GWASCAT_DG	24262325		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Coronary Restenosis	Coronary restenosis	Pubtator	16168296, 36814994	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Stenosis	Coronary Stenosis	BEFREE	22729917		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	19637360, 30015893, 38287401	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	30015893, 8050181		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	10936883		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	10588944, 11058715, 12032161, 12647273, 12876415, 17006673, 17721767, 18515784, 18823627, 20926921, 25463481, 27097985, 28986359, 30326043, 30660685, 31266036, 31446444, 8641022		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	11832353, 26214456, 28486003, 28846666, 32494035	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	24262292	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	10588944, 11058715, 12032161, 12647273, 12876415, 17006673, 17721767, 18515784, 18823627, 20926921, 25463481, 27097985, 28986359, 30326043, 30660685, 31266036, 31446444, 31665961, 8641022, 9404225		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes mellitus	Pubtator	1552236, 37686357	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes mellitus	Pubtator	17006673, 34460997, 36535927, 8096867	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes mellitus	Pubtator	31446444	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	22239554, 26901141	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	15189363, 15857159, 16757574, 17476032, 18985010, 19639021, 22368174, 23089926, 25612568, 29083408, 29617380, 30326043, 33351885, 34672391, 36535927, 37002989, 38127052, 38623619, 40179477, 8169525	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	12164879, 15049943, 30084679		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	10871197, 11058715, 11073182, 11126401, 12107736, 12655575, 12882931, 15189363, 15543643, 15857159, 16343038, 16357806, 16419488, 16741292, 16896939, 17299379, 17394430, 17476032, 18823627, 18985010, 20926921, 21419757, 21966368, 22368174, 23089926, 27898284, 29083408, 29124482, 29497783, 30084679, 30326043, 31585025, 31772941, 7669092, 7962342, 8325986, 8621801, 8641022		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	LHGDN	11947965		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	29632382		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Ketoacidosis	Diabetic ketoacidosis	Pubtator	26901141	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	36919187	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	11096142, 16813599, 31772941		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	LHGDN	16813599		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	31698464		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	10559015, 10636447, 10729390, 10974229, 11073182, 11140837, 11260209, 11441189, 12456348, 12483461, 12862202, 16106048, 16343038, 16635607, 16741292, 16990047, 17700364, 18693040, 19639021, 20861163, 21431783, 22236405, 23089926, 23623643, 24704626, 26342331, 29104012, 29124482, 30096295, 30550765, 30893111, 31002917, 31034941, 31227920, 8790727, 8907213, 8960833, 9017514, 9430364, 9678774		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dyslipidemias	Dyslipidemias	Pubtator	12837664, 15961789, 16106048, 19639021, 23089926, 24704626, 25897955, 28315561, 30210108, 30944368, 34460997, 34921821, 36419087, 8732773, 9017514, 9508003	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dyslipidemias	Dyslipidemias	LHGDN	15562208, 16343038		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dyslipidemias	Dyslipidemias	CTD_human_DG	17952847		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dystrophia myotonica 2	Myotonic dystrophy	BEFREE	23053881, 31323462		★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	10636447		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	27288544		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	27288544	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	30045256		★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	BEFREE	30660685		★☆☆☆☆ Found in Text Mining only
Eruptive xanthoma	Xanthoma	BEFREE	25863041		★☆☆☆☆ Found in Text Mining only
Eruptive xanthoma	Xanthoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	12571619, 12862202, 15127290, 15253101, 15257172, 15749185		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	12862202, 15253101, 19639021	Associate	★☆☆☆☆ Found in Text Mining only
Familial hypercholesterolemia - homozygous	Hypercholesterolemia	BEFREE	14660566, 29424317		★☆☆☆☆ Found in Text Mining only
Familial lipoprotein lipase deficiency	Lipoprotein Lipase Deficiency	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial partial lipodystrophy	Partial Lipodystrophy	BEFREE	31035285		★☆☆☆☆ Found in Text Mining only
Familial Partial Lipodystrophy, Type 2	Partial Lipodystrophy	BEFREE	18805829		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	29402273		★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	29402273		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	19301078		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	23110339	Stimulate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	29908922		★☆☆☆☆ Found in Text Mining only
Folic Acid Deficiency	Folic Acid Deficiency	BEFREE	30240347		★☆☆☆☆ Found in Text Mining only
FRIEDREICH ATAXIA 1	Friedreich Ataxia	BEFREE	29402273		★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	19780863		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	27864281, 31169500		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	27864281	Associate	★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type I	Glycogen Storage Disease	BEFREE	11757580		★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type II	Glycogen storage disease	Pubtator	25205864	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	12408999, 12647273, 9430364		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	29419410		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure	Heart failure	Pubtator	35945262	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure	Heart failure	Pubtator	39276349	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	29206143		★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Pancreatitis	Pubtator	37603299	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	12059987, 1943724, 26709473, 7749858		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	1943724		★☆☆☆☆ Found in Text Mining only
Hyperbilirubinemia	Hyperbilirubinemia	BEFREE	11468054		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	11477088, 14660566, 15122303, 16894468, 20347446, 28576574, 31302760, 8349676		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypercholesterolemia	Hypercholesterolemia	CTD_human_DG	21852083		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypercholesterolemia	Hypercholesterolemia	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypercholesterolemia	Hypercholesterolemia	GENOMICS_ENGLAND_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypercholesterolemia, Familial	Hypercholesterolemia	BEFREE	10559015, 11683775, 19558660, 27039080, 7583547, 8097805, 9498535, 9708657		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypercholesterolemia, Familial	Hypercholesterolemia	CTD_human_DG	16030523		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperglycemia	Hyperglycemia	BEFREE	12655575, 28986359		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	LHGDN	12655575, 14984315		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	14984315	Inhibit	★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	10488074, 11334409, 18535540, 19318514, 20347446, 7749885, 7758882, 8732773, 9587070		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	LHGDN	14984315, 18535540		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	Pubtator	8732773	Associate	★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	10559017, 11032739, 14660566, 15576362, 15639492, 16200213, 16364275, 19155782, 24009459, 24646025, 2719595, 28891316, 31002917, 7583546, 8724108, 9264396, 9342484, 9382958		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperlipidemia	Hyperlipidemia	LHGDN	14660566, 16822320		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperlipidemia	Hyperlipidemia	CTD_human_DG	17658632		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperlipidemia	Hyperlipidemia	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperlipidemia Familial Combined	Hyperlipidemia	Pubtator	1619366, 16822320, 19335919, 34087978, 7753827, 9017514	Associate	★☆☆☆☆ Found in Text Mining only
Hyperlipidemia, Familial Combined	Hyperlipidemia	BEFREE	10327279, 10924721, 10946021, 12370850, 12915220, 15469419, 16822320, 16938803, 17848837, 19335919, 26342331, 31599081, 3812212, 7753827, 8541837, 8808493, 8872057, 8956036, 8989135, 9017514, 9157946, 9215535, 9678774, 9717061		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperlipidemia, Familial Combined	Hyperlipidemia	LHGDN	12370850		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperlipidemia, Familial Combined	Hyperlipidemia	UNIPROT_DG	12966036, 7647785, 8728326, 8872057, 9662394, 9719626		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperlipidemia, Familial Combined	Hyperlipidemia	GENOMICS_ENGLAND_DG	27604308		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperlipidemia, Familial Combined	Hyperlipidemia	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperlipidemia, Familial Combined	Hyperlipidemia	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperlipidemias	Hyperlipidemia	Pubtator	10484613, 15256764, 16200213, 16822320, 1968704, 23991054, 30147083, 34460997, 7912254, 8169525, 8432854	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperlipoproteinemia Type I	Hyperlipoproteinemia	BEFREE	10077655, 10191298, 10481930, 10576767, 10660334, 10735636, 11068186, 11099402, 11134145, 11334614, 11425044, 11983347, 1511985, 1518507, 1524414, 1562620, 1576758, 15840743, 1598907, 16174715, 1639392, 16431216, 16630553, 1702428, 17299085, 1737848, 1752947, 17542893, 1761570, 17706445, 18275685, 1872917, 1907278, 192498, 19447388, 2010533, 20427244, 21085708, 2121025, 2205700, 22095987, 22540257, 22717743, 2349938, 23761384, 24009459, 24060958, 24291057, 24299335, 24788417, 25387803, 25470695, 25559420, 25936310, 25966443, 26892137, 27055971, 2719595, 27578112, 27578123, 28107429, 28114790, 28916403, 28927429, 29153744, 29288010, 29303250, 29304082, 29479812, 29641318, 29748148, 29784572, 30183397, 30318066, 30389453, 31035285, 3141684, 3559389, 3983953, 6645961, 6833877, 7266379, 7706936, 7753827, 7897314, 7906986, 8077845, 8099055, 8288243, 8325986, 8486765, 8728326, 8843465, 8973094, 9017424, 9026529, 9225235, 923094, 9261273, 9298816, 9323055, 9350308, 9392497, 9409224, 9627147, 9627528, 9714430, 9730139		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperlipoproteinemia Type I	Hyperlipoproteinemia	Pubtator	10191298, 10787434, 11993791, 1479292, 1521525, 1598907, 1619366, 16200213, 1674945, 17468530, 1752947, 1907278, 1969408, 1975597, 2010533, 2038366, 2121025, 2205700, 22095987, 22717743, 23415432, 2349938, 24299335, 24788417, 24886863, 25585702, 26079787, 26337181, 27578112, 28267856, 2914262, 29288010, 29748148, 30210108, 30685441, 32375710, 35923617, 35960041, 36476373, 36879129, 37568214, 7706936, 7751824, 7806969, 7868979, 7897314, 7912254, 8077845, 8301230, 8728326, 8778602, 9350308, 9487335, 9627147	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperlipoproteinemia Type I	Hyperlipoproteinemia	UNIPROT_DG	10660334, 10787434, 11068186, 11099402, 11134145, 11441134, 11893776, 12204001, 12641539, 1371284, 1400331, 1479292, 14984478, 15185149, 1521525, 15256764, 15877202, 1598907, 1619366, 1639392, 1674945, 1702428, 1730727, 1752947, 1907278, 1969408, 1975597, 2010533, 2038366, 2110364, 2121025, 26725083, 27578112, 30559189, 7806969, 7906986, 7912254, 7999071, 8077845, 8096693, 8135797, 8288243, 8301230, 8325986, 8486765, 8728326, 8778602, 8858123, 8956048, 8956052, 9279761, 9298816, 9498099, 9714430, 9719626		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperlipoproteinemia Type I	Hyperlipoproteinemia	Pubtator	10740731, 15256764, 1702428, 1752947, 1761570, 1907278, 1968704, 1969408, 1975597, 2038366, 2536938, 26079787, 26337181, 26489817, 30210108, 30948399, 31962008, 7897314, 7912254, 8432854, 9026529, 9350308, 9627147, 9973300	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperlipoproteinemia Type I	Hyperlipoproteinemia	GENOMICS_ENGLAND_DG	12408192, 27604308		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperlipoproteinemia Type I	Hyperlipoproteinemia	CLINVAR_DG	1505655, 15877202, 1674945, 16972177, 1702428, 17717288, 22095987, 25966443, 27055971, 27573733		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperlipoproteinemia Type I	Hyperlipoproteinemia	LHGDN	16460718		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperlipoproteinemia Type I	Hyperlipoproteinemia	ORPHANET_DG	24589565		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperlipoproteinemia Type I	Hyperlipoproteinemia	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperlipoproteinemia Type II	Hyperlipoproteinemia	Pubtator	11861663, 27039080, 36648309, 8808493, 9026529	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperlipoproteinemia Type IIa	Hyperlipoproteinemia	BEFREE	10559015, 11683775, 11861663, 27039080, 7583547, 8097805, 9498535, 9708657		★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type IIa	Hyperlipoproteinemia	CTD_human_DG	16030523		★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type IIb	Hyperlipoproteinemia	CTD_human_DG	16030523		★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type IIb	Hyperlipoproteinemia	BEFREE	17848837, 9026529		★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type III	Hyperlipoproteinemia	BEFREE	17727701, 21159338, 7583546, 7980718, 9587070		★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type III	Hyperlipoproteinemia	Pubtator	19034316	Associate	★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type IV	Hyperlipoproteinemia	BEFREE	12876415, 191790, 1943724, 28548960, 3812212, 7868979, 7962342, 8989135, 9209790		★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type IV	Hyperlipoproteinemia	Pubtator	32353702, 33592566, 7706936, 7868979	Associate	★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type IV	Hyperlipoproteinemia	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type V	Hyperlipoproteinemia	BEFREE	16200213		★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type V	Hyperlipoproteinemia	Pubtator	7706936	Associate	★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemias	Hyperlipoproteinemia	BEFREE	1943724, 7583546		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperlipoproteinemias	Hyperlipoproteinemia	Pubtator	7706936	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperprolactinemia	Hyperprolactinemia	BEFREE	18535540		★☆☆☆☆ Found in Text Mining only
Hyperprolactinemia	Hyperprolactinemia	LHGDN	18535540		★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Hypersensitivity	Pubtator	1512512, 26489817	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	12862202, 15253101, 17006673, 19772655, 20332647, 23089926, 25587205, 38127052, 8169525	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	BEFREE	10100092, 12862202, 15253101, 15482260, 16132104, 16430904, 17006673, 17562973, 18649389, 19191728, 19664517, 20596061, 23089926, 23337395, 28640651, 9607391		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	LHGDN	12746411, 15257172, 15749185, 16132104, 16430904, 18649389		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	CTD_human_DG	22228705		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertriglyceridemia	Hypertriglyceridemia	Pubtator	10484613, 10787434, 11593500, 11714860, 1355102, 16861622, 16864937, 17299085, 17476032, 17919884, 19639021, 1969408, 19820022, 20429872, 20657596, 22008945, 22095987, 23151256, 23836555, 24614124, 24646025, 24788417, 24886863, 25566792, 25585702, 26079787, 26337181, 26772541, 26901141, 27578112, 29046332, 29910226, 29921298, 30885219, 31203594, 31519763, 31962008, 32115487, 32264896, 35568684, 35741823, 35923617, 36476373, 36613909, 36689289, 37550668, 37568214, 38346769, 39278772, 39662927, 4719678, 7706936, 7751824, 8169525, 8732773	Associate	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Hypertriglyceridemia	Hypertriglyceridemia	Pubtator	1552236	Inhibit	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Hypoalbuminemia	Hypoalbuminemia	BEFREE	1943724		★☆☆☆☆ Found in Text Mining only
Hypoalphalipoproteinemias	Hypoalphalipoproteinemia	Pubtator	15292370, 30333156	Associate	★☆☆☆☆ Found in Text Mining only
Hypoalphalipoproteinemias	Hypoalphalipoproteinemia	BEFREE	9730139		★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	10488074		★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	Pubtator	26999119	Associate	★☆☆☆☆ Found in Text Mining only
Hypotriglyceridemia	Hypotriglyceridemia	BEFREE	16081640, 18258818		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	25889814	Associate	★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	25595992		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	8050181		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	8050181	Associate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	21854610, 21966368, 25809647, 26214456, 26420199, 31167211, 31208038	Associate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	22368174	Inhibit	★☆☆☆☆ Found in Text Mining only
Intracranial Arteriovenous Malformations	Intracranial arteriovenous malformation	Pubtator	30045256	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	11921083, 12636935, 15896905, 16519597, 17328917, 21193198, 21816453, 22541364, 22810051, 29718838, 9352244		★☆☆☆☆ Found in Text Mining only
Isolated somatotropin deficiency	Isolated Somatotropin Deficiency	BEFREE	14764824		★☆☆☆☆ Found in Text Mining only
Ketosis	Ketosis	BEFREE	15049943		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	15189363		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	15189363, 31286991	Associate	★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	17291198		★☆☆☆☆ Found in Text Mining only
Lipase deficiency combined	Lipoprotein lipase deficiency with hepatic triglyceride lipase deficiency	BEFREE	17994020		★☆☆☆☆ Found in Text Mining only
Lipid Metabolism Disorders	Lipid Metabolism Disorders	BEFREE	12042669, 27055971, 28941594, 30218657, 31398934		★☆☆☆☆ Found in Text Mining only
Lipidemia retinalis	Lipidemia Retinalis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	BEFREE	28502512		★☆☆☆☆ Found in Text Mining only
Lipoidosis	Lipoidosis	BEFREE	8589283		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	18245957, 27264722		★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	31740790	Associate	★☆☆☆☆ Found in Text Mining only
Long chain 3-hydroxyacyl-CoA dehydrogenase deficiency	Long Chain 3-Hydroxyacyl-CoA Dehydrogenase Deficiency	BEFREE	30084679		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	17620184		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	17620184	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	36397145	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	18703425	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	28230270		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	18703425	Associate	★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	20385819, 21906714, 24223199	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	27864281		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	16809441, 17428620, 31806729		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	27288544		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	17620184		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15386377, 17319789, 19004026, 8291601		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	15386377		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10362129, 17620184, 21044743, 23880163, 29304175, 7698754, 8084616		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	CTD_human_DG	15059925		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	7970728		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	30183069		★☆☆☆☆ Found in Text Mining only
Marginal Zone B-Cell Lymphoma	B-Cell Lymphoma	BEFREE	28230270		★☆☆☆☆ Found in Text Mining only
Maternal hypertension	Maternal hypertension	BEFREE	16369102		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	21606880	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	19318514, 24916532, 25554608, 25811490, 2803349, 28327359, 30147083, 30648986, 8026810		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	25811490, 33003532, 35456470, 36690263, 38003484	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	21854610, 24200052, 26370976, 26420199, 27827461, 29046332, 29412239, 34503513, 38201907, 40179477, 8169525	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome	Metabolic syndrome	Pubtator	39868518	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	11895454, 11914743, 14693718, 15001574, 15928243, 16343038, 16755277, 16941273, 17032721, 17555736, 19191728, 19642912, 21840003, 21854610, 23927945, 24200052, 25023634, 26370976, 26507551, 27676127, 27827461, 28502509, 29046332, 29412239, 30381540, 30910668, 31034941, 31234537, 31284400, 7905375		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	GWASCAT_DG	21386085, 22399527, 30382898		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	GWASDB_DG	21386085, 22399527		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	29938581	Associate	★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	18703425		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	7868979	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	21454202, 29805699		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	31130950		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	31130950	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Diseases, Secondary	Myocardial Diseases	CTD_human_DG	10533957		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	10484057, 10974229, 11427211, 12048130, 1466662, 15256516, 15292372, 16519597, 16894468, 17484619, 18194851, 18823627, 21252145, 25738804, 28685248, 7834891, 8576637, 8576640, 8724108, 9555857		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	LHGDN	15292372, 17484619		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	15292372, 16519597, 24407533, 37906604, 8576637, 8576640	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	21252145, 39868518	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	BEFREE	10359734, 10364086, 10704617, 10821816, 12208477, 16418216, 17006673, 17436307, 20347446, 21816453, 9120004, 9323055		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	LHGDN	12208477		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial ischemia	Pubtator	17006673, 17436307, 29396305, 9120004	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial ischemia	Pubtator	39868518	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocarditis	Myocarditis	Pubtator	8576640	Associate	★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	12451608, 7635990		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NADH cytochrome B5 reductase deficiency	Nadh-Cytochrome B5 Reductase Deficiency	BEFREE	11126401		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10491435, 17549480, 17620184, 19004026, 23880163, 27864281, 29206143, 30862716, 7689419, 8084616, 9770500		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	15827892, 8589283		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	12501246	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	12501246	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	LHGDN	12501246		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	28777751		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	17704301, 25554608, 28802640, 29497783, 30572788, 31480575		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	10362129, 12114433, 21044743, 23880163		★☆☆☆☆ Found in Text Mining only
Nuchal bleb, familial	Nuchal Bleb	BEFREE	16822320, 19335919, 8541837, 8872057, 9026529, 9717061		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	11833051, 11996946, 12352010, 14660566, 15795426, 16534528, 16552397, 17299379, 18693040, 19168150, 19318514, 19534808, 19629056, 19772655, 20926921, 21431783, 22540257, 23036713, 23089926, 24262292, 25156894, 25579610, 25784555, 26483159, 27097985, 27898284, 30698048, 31034941, 31167211, 7598704, 8724108, 9272150, 9278582, 9326333, 9404225		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	15060087, 16757574, 19185650, 19629056, 19772655, 19818126, 23089926, 2320065, 24200052, 25132069, 25156894, 25612568, 25809647, 29335416, 31167211, 33003532, 33500527, 35052431, 36535927, 37901192, 39458497, 8169525, 8227334	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	CTD_human_DG	18344982		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	32494035, 36371454	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity Abdominal	Obesity	Pubtator	35807893	Associate	★☆☆☆☆ Found in Text Mining only
Obesity Morbid	Obesity	Pubtator	29335416	Stimulate	★☆☆☆☆ Found in Text Mining only
Obesity, Morbid	Obesity	BEFREE	18515784, 23623643		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	32259644	Associate	★☆☆☆☆ Found in Text Mining only
Osteogenesis imperfecta type 3	Osteogenesis imperfecta	Pubtator	8576637	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	17549480		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	7912239	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Hyperstimulation Syndrome	Ovarian Hyperstimulation Syndrome	BEFREE	28534980		★☆☆☆☆ Found in Text Mining only
Ovarian Hyperstimulation Syndrome	Ovarian hyperstimulation syndrome	Pubtator	28534980	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	31969186, 36012230	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	11134145, 11412826, 11757580, 12883259, 15719847, 16972177, 19034041, 19534808, 22438229, 22717743, 23126631, 23527320, 24646025, 25559420, 25966443, 26079787, 27578112, 29304082, 29842811, 30147083, 30352774, 30948399, 31390500, 31645434, 8554252, 8728326, 9323055, 9498099		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatitis	Pancreatitis	Pubtator	16106048, 21880794, 22239554, 24646025, 26079787, 27578112, 29288010, 29921298, 30147083, 30420299, 30948399, 31901151, 31962008, 32264896, 35923617, 36689289, 37550668, 37568214, 38530959, 7912254, 8301230	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatitis	Pancreatitis	LHGDN	17706445		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatitis	Pancreatitis	CTD_human_DG	18936103		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatitis	Pancreatitis	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatitis	Pancreatitis	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatitis, Chronic	Pancreatitis	BEFREE	10560236, 10619999, 11134145, 12883259, 16174715, 16431216, 19034041, 25470695, 26892137, 28548960, 29153744, 29288010, 8301230		★☆☆☆☆ Found in Text Mining only
Pediatric Obesity	Childhood obesity	BEFREE	21431783		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	34805411	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	31070467	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	23053881, 8835323		★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	GWASCAT_DG	31285632		★☆☆☆☆ Found in Text Mining only
Peripheral arterial stenosis	Peripheral arterial stenosis	BEFREE	8835323		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	25554608, 30084679		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	25554608, 28534980, 33228780	Associate	★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	29650292		★☆☆☆☆ Found in Text Mining only
Premature arteriosclerosis	Arteriosclerosis	BEFREE	11122694		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	10936883		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15386377, 17319789, 19004026		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	15386377		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	19004026		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	19004026		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	19004026, 37298233, 40563400	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Proteinuria	Proteinuria	Pubtator	31286991	Associate	★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	30140663		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	33416099	Associate	★☆☆☆☆ Found in Text Mining only
Recurrent pancreatitis	Pancreatitis	BEFREE	10560236, 10619999, 11134145, 12883259, 16174715, 16431216, 25470695, 26892137, 28548960, 29153744, 29288010, 8301230		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	7912239	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	17726453, 21862952		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	21862952		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Senile Plaques	Senile Plaques	BEFREE	12133567, 21177248		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	21880794	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	LHGDN	17652898		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	12114433		★☆☆☆☆ Found in Text Mining only
Somatotropin deficiency	Somatotropin Deficiency	BEFREE	14764824		★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	30115630		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	19301078		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	27893427	Associate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	24990426	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	14693718, 7962342, 9785052		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	17072956, 8050181		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	LHGDN	17072956		★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	CTD_human_DG	12376462		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	38127052	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	10748193, 12866915, 18590804		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	16519597	Associate	★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom macroglobulinemia	Pubtator	18703425	Associate	★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	BEFREE	28230270, 31849108		★☆☆☆☆ Found in Text Mining only